P2RX7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• P2RX7 Polyclonal antibody (28207-1-AP)

• Featured Product
• KD/KO Validated

P2RX7 Polyclonal Antibody for WB, FC (Intra), ELISA

Cat No. 28207-1-AP Copied!

Publications (42)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF, FC (Intra), CoIP, ELISA

Synonyms

P2X7, Purinergic receptor

• 

  WB analysis using 28207-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28207-1-AP (P2RX7 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of RAW 264.7 using 28207-1-AP

  1x10^6 RAW 264.7 cells were intracellularly stained with 0.5 ug P2RX7 Polyclonal antibody (28207-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.5 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for P2RX7 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse cerebellum tissue
• Positive FC (Intra) detected in: RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28207-1-AP targets P2RX7 in WB, IHC, IF, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27700

  Product name: Recombinant human P2RX7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 382-589 aa of BC011913

  Sequence: YYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYS

• Full Name: purinergic receptor P2X, ligand-gated ion channel, 7
• Calculated Molecular Weight: 69 kDa
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: BC011913
• Gene Symbol: P2RX7
• Gene ID (NCBI): 5027
• RRID: AB_2881088
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99572
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nucleotides, the structural subunits of the nucleic acids, are also important extracellular signaling molecules. P2 receptors are a family of cell surface receptors that mediate a wide variety of physiologic effects in response to extracellular nucleotides. These receptors fall into two classes: P2X receptors, which are ligand-gated ion channels that mediate calcium and potassium fluxes in response to ATP, and P2Y receptors, which are G protein-coupled receptors (GPCRs) (PMID: 21724990). P2RX7 functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. P2RX7 is highly expressed by cells of the haemopoietic lineage and can mediate cell death, killing of infectious organisms, and regulation of the inflammatory response (PMID: 22102807).

Publications

What published studies show

The P2RX7 Polyclonal antibody (Cat# 28207-1-AP) has accumulated 42 citations across journals such as Nature Aging, Nature Communications, Cell Reports, Journal of Neuroinflammation, Clinical Cancer Research, Redox Biology, and Purinergic Signaling. Associated research fields include neuroinflammation, pyroptosis, ferroptosis, cancer biology, liver fibrosis, cardiovascular disease, diabetes, pain, and immunology. Applications span WB, IF, IHC, and CoIP in mouse, rat, human, and pig models.

Automatically generated from the 42 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Nat Aging; Extracellular vesicles derived from senescent hepatocytes drive pan-cancer metastasis in aging; Authors - Huilong Li
rat	IF	Nat Commun; KNN-based frequency-adjustable ferroelectric heterojunction and biomedical applications; Authors - Tao Zhang
mouse	WB	Nat Commun; Astrocytic neuroligin 3 regulates social memory and synaptic plasticity through adenosine signaling in male mice; Authors - Rui Dang
mouse	WB,IHC,IF,CoIP	J Adv Res; The purinergic receptor P2rx7 mediated ATP sensing is required to prevent bone aging by directing mitochondrial fitness of MSCs; Authors - Zimeng Zhuang
mouse	WB,IF	Redox Biol; Islet regeneration protein Reg3g promotes macrophage clearance of β cell-derived dysfunctional mitochondria-rich vesicles to mitigate T2DM.; Authors - Senlin Li
mouse	WB	J Nanobiotechnology; Carbon dots from purple sweet potato as a promising anti-inflammatory biomaterial for alleviating the LPS-induced inflammation in macrophages; Authors - Jiebang Jiang