• Featured Product
  • KD/KO Validated

P2RX7 Polyclonal antibody

P2RX7 Polyclonal Antibody for WB, FC (Intra), ELISA
Cat No. 28207-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF, FC (Intra), CoIP, ELISA

P2X7, Purinergic receptor

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, mouse cerebellum tissue
Positive FC (Intra) detected inRAW 264.7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28207-1-AP targets P2RX7 in WB, IHC, IF, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27700

Product name: Recombinant human P2RX7 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 382-589 aa of BC011913

Sequence: YYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYS

Predict reactive species
Full Name purinergic receptor P2X, ligand-gated ion channel, 7
Calculated Molecular Weight 69 kDa
Observed Molecular Weight 70-80 kDa
GenBank Accession NumberBC011913
Gene Symbol P2RX7
Gene ID (NCBI) 5027
RRIDAB_2881088
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ99572
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nucleotides, the structural subunits of the nucleic acids, are also important extracellular signaling molecules. P2 receptors are a family of cell surface receptors that mediate a wide variety of physiologic effects in response to extracellular nucleotides. These receptors fall into two classes: P2X receptors, which are ligand-gated ion channels that mediate calcium and potassium fluxes in response to ATP, and P2Y receptors, which are G protein-coupled receptors (GPCRs) (PMID: 21724990). P2RX7 functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. P2RX7 is highly expressed by cells of the haemopoietic lineage and can mediate cell death, killing of infectious organisms, and regulation of the inflammatory response (PMID: 22102807).

Protocols

Product Specific Protocols
FC protocol for P2RX7 antibody 28207-1-APDownload protocol
WB protocol for P2RX7 antibody 28207-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
rat,mouseWB

J Cell Physiol

Apelin-13/APJ induces cardiomyocyte hypertrophy by activating the Pannexin-1/P2X7 axis and FAM134B-dependent reticulophagy.

Authors - Yiyuan Yang
  • KD Validated
rat,mouseWB,IHC,IF

Front Pharmacol

Salidroside Ameliorates Depression by Suppressing NLRP3-Mediated Pyroptosis via P2X7/NF-κB/NLRP3 Signaling Pathway.

Authors - Yuhui Chai
humanWB

Biochem Biophys Res Commun

A438079 affects colorectal cancer cell proliferation, migration, apoptosis, and pyroptosis by inhibiting the P2X7 receptor.

Authors - Ying Zhang
humanWB,IHC

Adv Med Sci

The role of P2X7 receptor in prognosis and metastasis of colorectal cancer.

Authors - Ying Zhang
pigWB,IHC,IF

Biomolecules

Activation of Adenosine Triphosphate-Gated Purinergic 2 Receptor Channels by Transient Receptor Potential Vanilloid Subtype 4 in Cough Hypersensitivity

Authors - Wanzhen Li
humanIF

Clin Cancer Res

Visualization of P2X7 Receptors in Living Human Gliomas: an 18F-GSK1482160 PET Imaging and Neuropatholopy Study

Authors - Weiyan Zhou
Loading...
||
New chat

Able

正在加载,请稍候...