PABPC4 Monoclonal antibody, PBS Only

• 

  WB analysis using 68187-1-Ig (same clone as 68187-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68187-1-Ig (PABPC4 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68187-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 68187-1-Ig (same clone as 68187-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 68187-1-Ig (PABPC4 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68187-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 68187-1-Ig (same clone as 68187-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 68187-1-Ig (PABPC4 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68187-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 68187-1-Ig (same clone as 68187-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 68187-1-Ig (PABPC4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68187-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 68187-1-Ig (same clone as 68187-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 68187-1-Ig (PABPC4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68187-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 68187-1-Ig (same clone as 68187-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 68187-1-Ig (PABPC4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68187-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 68187-1-Ig (same clone as 68187-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 68187-1-Ig (PABPC4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68187-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 68187-1-Ig (same clone as 68187-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using PABPC4 antibody (68187-1-Ig, Clone: 1E6B3 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68187-1-PBS in a different storage buffer formulation.

PABPC4 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 68187-1-PBS

Clone No.1E6B3

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Activated platelet protein 1, APP 1, APP1, FLJ43938, iPABP, PABP 4, PABP4, PABPC4, Poly(A) binding protein 4

---

Product Information

68187-1-PBS targets PABPC4 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6813

  Product name: Recombinant human PABPC4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 285-631 aa of BC065540

  Sequence: QERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVMLEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGNAPASRGLPTTTQRVGVPTAVQNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQAPQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHHAKKEAAQKVGAVAAATS

• Full Name: poly(A) binding protein, cytoplasmic 4 (inducible form)
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 71 kDa
• GenBank Accession Number: BC065540
• Gene Symbol: PABPC4
• Gene ID (NCBI): 8761
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q13310
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Poly(A)-binding protein (PABP), a nucleocytoplasmic shuttling protein, has a fundamental role in promoting gene expression by enhancing mRNA translation and stability(PMID: 21940797). Poly(A)-binding protein 4 (PABPC4), one of the homologs of PABP, was initially identified as a human T-cell activation-induced protein. PABPC4 may also be involved in the regulation of protein translation in platelets and megakaryocytes or may participate in the binding or stabilization of polyadenylates in platelet dense granules(NCBI).