PAK1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PAK1 Polyclonal antibody (21401-1-AP)

• Featured Product
• KD/KO Validated

PAK1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 21401-1-AP

Publications(31)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

p65 PAK, p21-activated kinase 1, p21 activated kinase 1, EC:2.7.11.1, Alpha-PAK

• 

  WB analysis using 21401-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21401-1-AP (PAK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 21401-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21401-1-AP (PAK1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 21401-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 21401-1-AP (PAK1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 21401-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 21401-1-AP (PAK1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 21401-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21401-1-AP (PAK1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 21401-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 21401-1-AP (PAK1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 21401-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 21401-1-AP (PAK1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of K-562 using 21401-1-AP

  IP result of anti-PAK1 (IP:21401-1-AP, 4ug; Detection:21401-1-AP 1:1000) with K-562 cells lysate 3200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 21401-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21401-1-AP (PAK1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 21401-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21401-1-AP (PAK1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 21401-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 21401-1-AP (PAK1 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 21401-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 21401-1-AP (PAK1 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of C6 using 21401-1-AP

  Immunofluorescent analysis of C6 cells using 21401-1-AP (PAK1 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of C6 using 21401-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed C6 cells using PAK1 antibody (21401-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: C6 cells, Jurkat cells, NIH/3T3 cells, MCF-7 cells, HeLa cells, K-562 cells
• Positive IP detected in: K-562 cells
• Positive IHC detected in: mouse brain tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: C6 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21401-1-AP targets PAK1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16102

  Product name: Recombinant human PAK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 14-65 aa of BC109299

  Sequence: APPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTN

• Full Name: p21 protein (Cdc42/Rac)-activated kinase 1
• Calculated Molecular Weight: 553 aa, 62 kDa
• Observed Molecular Weight: 61-65 kDa
• GenBank Accession Number: BC109299
• Gene Symbol: PAK1
• Gene ID (NCBI): 5058
• RRID: AB_11232232
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13153
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The p21-Activated kinase 1 (PAK1), a member of serine-threonine kinases family, was initially identified as an interactor of the Rho GTPases RAC1 and CDC42, which affect a wide range of processes associated with cell motility, survival, metabolism, cell cycle, proliferation, transformation, stress, inflammation, and gene expression(PMID: 32863957). PAK1 is over-expressed in various malignancies such as ovarian, breast, lung, and bladder cancers, and is closely associated with tumor invasion.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nucleic Acids Res; DOCK7 protects against replication stress by promoting RPA stability on chromatin.; Authors - Ming Gao
mouse	WB	ACS Appl Mater Interfaces; Novel Thermosensitive Hydrogel Promotes Spinal Cord Repair by Regulating Mitochondrial Function.; Authors - Yi Li
mouse	IF,WB	Theranostics; Cdc42 Deficiency Leads To Epidermal Barrier Dysfunction by Regulating Intercellular Junctions and Keratinization of Epidermal Cells during Mouse Skin Development.; Authors - Min Zhang
rat	WB	Acta Pharmacol Sin; Salvianolic acid A prevented cerebrovascular endothelial injury caused by acute ischemic stroke through inhibiting the Src signaling pathway.; Authors - Cheng-di Liu
chicken	WB	Microbiol Spectr; Avian Hepatitis E Virus ORF2 Protein Interacts with Rap1b to Induce Cytoskeleton Rearrangement That Facilitates Virus Internalization.; Authors - Beibei Zhang
mouse	WB	Sci Rep; Nicotine facilitates VSMC dysfunction through a miR-200b/RhoGDIA/cytoskeleton module.; Authors - Dongli Liang