PANX1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PANX1 Polyclonal antibody (12595-1-AP)

• Featured Product
• KD/KO Validated

PANX1 Polyclonal Antibody for WB, ELISA

Cat No. 12595-1-AP Copied!

Publications (23)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

pannexin 1, OZEMA7, OOMD7, MRS1, Innexin

• 

  WB analysis using 12595-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12595-1-AP (PANX1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SH-SY5Y using 12595-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 12595-1-AP (PANX1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PANX1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, SH-SY5Y cells, K-562 cells, MDA-MB-231 cells, C2C12 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12595-1-AP targets PANX1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3174

  Product name: Recombinant human PANX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 126-426 aa of BC016931

  Sequence: FWRFAAAPHICSDLKFIMEELDKVYNRAIKAAKSARDLDMRDGACSVPGVTENLGQSLWEVSESHFKYPIVEQYLKTKKNSNNLIIKYISCRLLTLIIILLACIYLGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVINLVVYVLLAPVVVYTLFVPFRQKTDVLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC

• Full Name: pannexin 1
• Calculated Molecular Weight: 426 aa, 48 kDa
• Observed Molecular Weight: 45-50 kDa, 90 kDa
• GenBank Accession Number: BC016931
• Gene Symbol: PANX1
• Gene ID (NCBI): 24145
• RRID: AB_2159186
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96RD7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PANX1, also named as MRS1, belongs to the pannexin family. It plays a role as a Ca2+-leak channel to regulate ER Ca2+ homeostasis. It is a structural component of the gap junctions and the hemichannels. PANX1 induced the formation of intercellular channels with characteristics of gap junctions. PANX1 is 48-kDa protein which contains 4 transmembrane domains and cytoplasmic N and C termini. It is a mediator of find-me signal/nucleotide release from apoptotic cells. Western blot for Panx1 was also seen in two bands at 45~50 kDa and ~90 kDa. The band of ~90 kDa corresponding to the Panx1 dimer size. (PMID: 24590064, PMID: 19009624)

Publications

What published studies show

The anti-Pannexin-1 antibody (Cat# 12595-1-AP) has 23 citations across journals including Theranostics, Br J Pharmacol, Sci Signal, Life Sci, Int J Mol Sci, PLoS Pathog, Cancer Sci, Sci Rep, Neurochem Res, Front Oncol, PLoS One, and Elife. Research fields span oncology (pancreatic, lung cancers), neurology (epilepsy, cerebral ischemia), immunology (sepsis, inflammasome activation), metabolic regulation (hepatic lipogenesis, diabetic cardiomyopathy), cell death (pyroptosis, ferroptosis), and structural biology.

Automatically generated from the 23 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IF	Mil Med Res; PANX1-mediated ATP release confers FAM3A's suppression effects on hepatic gluconeogenesis and lipogenesis; Authors - Cheng-Qing Hu
human	IHC	Theranostics; Mitochondrial Protein UQCRC1 is Oncogenic and a Potential Therapeutic Target for Pancreatic Cancer.; Authors - Qing Wang
rat	WB	Br J Pharmacol; Exploring the pathophysiology underlying clozapine-induced enhancement of glutamatergic transmission through L-glutamate and D-serine release associated with pannexin1 hemichannels; Authors - Motohiro Okada
human	WB	Sci Signal; Structures of human pannexin-1 in nanodiscs reveal gating mediated by dynamic movement of the N terminus and phospholipids.; Authors - Maki Kuzuya
human,mouse	WB,IHC	Life Sci; Inhibiting pannexin-1 alleviates sepsis-induced acute kidney injury via decreasing NLRP3 inflammasome activation and cell apoptosis.; Authors - Guanwen Huang ; KD Validated
human	WB	Int J Mol Sci; Subcortical Circuits Among Pedunculopontine Nucleus, Thalamus and Basal Ganglia Play Important Roles in Paroxysmal Arousal in Genetic Rat Models of Autosomal Dominant Sleep-Related Hypermotor Epilepsy; Authors - Ruri Okubo