Recombinant human PAQR6 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag25554
Synonyms
FLJ22672
Validation Data Gallery View All
Product Information
| Peptide Sequence |
LESPGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCGQEA
(175-218 aa encoded by BC058509) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
