Recombinant human PCNT protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Cat no : Ag27248
Synonyms
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MDLEQLQQKQVNDHPPEQCGMFTVSDHPPEQHGMFTVGDHPPEQRGMFTVSDHPPEQHGMFTVSDHPPEQRGMFTISDHQPEQRGMFTVSDHTPEQRGIFTI
(100-200 aa encoded by AK093923) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
