PCOTH Polyclonal antibody, PBS Only

• 

  IHC staining of mouse testis using 24564-1-AP (same clone as 24564-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 24564-1-AP (PCOTH antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24564-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 24564-1-AP (same clone as 24564-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 24564-1-AP (PCOTH antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24564-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 24564-1-AP (same clone as 24564-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 24564-1-AP (PCOTH antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24564-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 24564-1-AP (same clone as 24564-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 24564-1-AP (PCOTH antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24564-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 24564-1-AP (same clone as 24564-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using PCOTH antibody (24564-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 24564-1-PBS in a different storage buffer formulation.

PCOTH Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 24564-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

24564-1-PBS targets PCOTH in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20092

  Product name: Recombinant human PCOTH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 8-107 aa of BC142999

  Sequence: GTSEEGNLLSTVSPTVKALFGKTRVSPIFPFSPRSPFQPLIPRTPGSPWGPVGPASPLGPGFPIGPMGPGKPVGPKGPMLPLGPSGPVGPTSPLFPFCP

• Full Name: prostate collagen triple helix
• Calculated Molecular Weight: 107 aa, 11 kDa
• GenBank Accession Number: BC142999
• Gene Symbol: PCOTH
• Gene ID (NCBI): 542767
• RRID: AB_2918084
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q58A44
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PCOTH may be involved in growth and survival of prostate cancer cells through the TAF-Ibeta pathway.