Recombinant human PDCD7 protein
Source
e coli.-derived, PET30a
Tag
6*His
Format
Liquid
Cat no : Ag22890
Synonyms
PDCD7, programmed cell death 7
Validation Data Gallery View All
Product Information
| Peptide Sequence |
PPASADETFTHHLQRLRKLIKKRSELYEAEERALRVMLEGEQEEERKRELEKKQRKEKEKILLQKREIESKLFGDPDEFPLAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWATAVKLH
(340-485 aa encoded by BC016992) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
