PDCL2 Polyclonal antibody

• 

  WB analysis using 17407-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17407-1-AP (PDCL2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 17407-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 17407-1-AP (PDCL2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 17407-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 17407-1-AP (PDCL2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 17407-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 17407-1-AP (PDCL2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human testis using 17407-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 17407-1-AP (PDCL2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 17407-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 17407-1-AP (PDCL2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human spleen using 17407-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 17407-1-AP (PDCL2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human spleen using 17407-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 17407-1-AP (PDCL2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human ovary using 17407-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 17407-1-AP (PDCL2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human ovary using 17407-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 17407-1-AP (PDCL2 antibody) at dilution of 1:50 (under 40x lens).

PDCL2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17407-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IHC, ELISA

Synonyms

GCPHLP, PDCL2, phosducin like 2, Phosducin like protein 2

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue
• Positive IHC detected in: human kidney tissue, human ovary tissue, human spleen tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:4000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

17407-1-AP targets PDCL2 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11427

  Product name: Recombinant human PDCL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-250 aa of BC034431

  Sequence: MQDPNEDTEWNDILRDFGILPPKEESKDEIEEMVLRLQKEAMVKPFEKMTLAQLKEAEDEFNEEDMQAVETYRKKRLQEWKALKKKQKFGELREISGNQYVNEVTNAEEDVWVIIHLYRSSIPMCLLVNQHLSLLARKFPETKFVKAIVNSCIQHYHDNCLPTIFVYKNGQIEAKFIGIIECGGINLKLEELEWKLAEVGAIQTDLEENPRKDMVDMMVSSIRNTSIHDDSDSSNSDNEPNREKYSINSF

• Full Name: phosducin-like 2
• Calculated Molecular Weight: 250 aa, 29 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC034431
• Gene Symbol: PDCL2
• Gene ID (NCBI): 132954
• RRID: AB_2299492
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N4E4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Andrology; PDCL2 is essential for sperm acrosome formation and male fertility in mice; Authors - Yoshitaka Fujihara
human	IHC	Transl Androl Urol; Identification of PDCL2 as a candidate marker in Sertoli cell-only syndrome by chromatin immunoprecipitation-sequencing and bioinformatics analysis; Authors - Yu Yang
mouse	WB	PNAS Nexus; Tex46 knockout male mice are sterile secondary to sperm head malformations and failure to penetrate through the zona pellucida; Authors - Yoshitaka Fujihara