PDE10A Polyclonal antibody

• 

  IP experiment of mouse brain using 18078-1-AP

  IP result of anti-PDE10A (IP:18078-1-AP, 4ug; Detection:18078-1-AP 1:300) with mouse brain tissue lysate 5200ug.

• 

  IHC staining of mouse brain using 18078-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18078-1-AP (PDE10A antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 18078-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18078-1-AP (PDE10A antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 18078-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using PDE10A antibody (18078-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

PDE10A Polyclonal Antibody for IHC, IF/ICC, IP, ELISA

Cat No. 18078-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

phosphodiesterase 10A, HSPDE10A, EC:3.1.4.17, cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

---

Tested Applications

• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below
• IHC: See 1 publications below
• IF: See 3 publications below
• CoIP: See 1 publications below

Product Information

18078-1-AP targets PDE10A in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12771

  Product name: Recombinant human PDE10A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 434-779 aa of BC104860

  Sequence: KLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSVAQKAAASED

• Full Name: phosphodiesterase 10A
• Calculated Molecular Weight: 779 aa, 88 kDa
• Observed Molecular Weight: 89 kDa
• GenBank Accession Number: BC104860
• Gene Symbol: PDE10A
• Gene ID (NCBI): 10846
• RRID: AB_2878492
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y233
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDE10A (Phosphodiesterase 10A) is a single member of the PDE10 protein family, and it catalyzes both cAMP and cGMP hydrolysis (PMID: 34550322). The literature on PDE10A has been focused on psychiatric and neurological disorders because PDE10A expression is enriched in the striatal region of the brain under normal conditions (PMID: 12967715). Moreover, PDE10A expression is induced in various human tumor cell lines and PDE10A inhibition suppresses tumor cell growth (PMID: 37232184).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Environ Int; Exposure to dithiocarbamate fungicide maneb in vitro and in vivo: Neuronal apoptosis and underlying mechanisms; Authors - Chaoyang Liu
human	WB	EMBO J; A genetically targeted reporter for PET imaging of deep neuronal circuits in mammalian brains.; Authors - Masafumi Shimojo
human	WB,IF	Cell Mol Life Sci; Crip2 affects vascular development by fine-tuning endothelial cell aggregation and proliferation; Authors - Shuaiqi Yang
bovine	WB	Andrology; Characterization of cAMP-phosphodiesterase activity in bovine seminal plasma.; Authors - A Bergeron
bovine	WB,IF	Andrology; Papaverine-sensitive phosphodiesterase activity is measured in bovine spermatozoa.; Authors - A Bergeron
human	WB,IHC,IF,CoIP	Biochem Pharmacol; N6-methyladenosine-modified RNF220 induces cisplatin resistance and immune escape via regulating PDE10A K48-linked ubiquitination in bladder cancer; Authors - Kai Li