PDE1C Polyclonal antibody

• 

  WB analysis of human heart using 13785-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 13785-1-AP (PDE1C antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse heart using 13785-1-AP

  IP result of anti-PDE1C (IP:13785-1-AP, 4ug; Detection:13785-1-AP 1:500) with mouse heart tissue lysate 4000ug.

PDE1C Polyclonal Antibody for WB, IP, ELISA

Cat No. 13785-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IP, ELISA

Synonyms

Cam PDE 1C, hCam 3, Hcam3, PDE1C

---

Tested Applications

• Positive WB detected in: human heart tissue
• Positive IP detected in: mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

13785-1-AP targets PDE1C in WB, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4798

  Product name: Recombinant human PDE1C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 284-634 aa of BC022525

  Sequence: RSDPAILYNDRSVLENHHLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPEAIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKSTMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKRSGVKTSGSEGSAPINNSVISVDYKSFKATWTEVVHINRERWRAKVPKEEKAKKEAEEKARMAAEEQQKEMEAKSQAEEGASGKAEKKTSGETKNQVNGTRANKSDNPRGKNSKAEKSSGEQQQNGDFKDGKNKTDKKDHSNIGNDSKKTDDSQE

• Full Name: phosphodiesterase 1C, calmodulin-dependent 70kDa
• Calculated Molecular Weight: 634 aa, 72 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC022525
• Gene Symbol: PDE1C
• Gene ID (NCBI): 5137
• RRID: AB_2268145
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14123
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclic nucleotide phosphodiesterases (PDEs) catalyze hydrolysis of the cyclic nucleotides cAMP and cGMP to the corresponding nucleoside 5-prime-monophosphates. PDE1C, is calmodulin-dependent PDEs (CaM-PDEs) that are stimulated by a calcium-calmodulin complex. Expression of PDE1C may be an important component in signal transduction pathways mediated by calcium that permit cell cycle traverse and proliferation(PMID:9366577). It has 2 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Sci Adv; RasGRP1 is a causal factor in the development of l-DOPA-induced dyskinesia in Parkinson's disease.; Authors - Mehdi Eshraghi
rat	WB	Free Radic Biol Med; Poly (I:C) impairs NO donor-induced relaxation by overexposure to NO via the NF-kappa B/iNOS pathway in rat superior mesenteric arteries.; Authors - Makoto Ando