• Featured Product
  • KD/KO Validated

PDK1 Polyclonal antibody

PDK1 Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 18262-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial, EC:2.7.11.2, PDH kinase 1, PDHK1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue, HEK-293 cells, NIH/3T3 cells, mouse liver tissue, rat liver tissue
Positive IP detected inSiHa cells
Positive IHC detected inhuman liver cancer tissue, human heart tissue, human kidney tissue, human breast cancer tissue, mouse kidney tissue, rat kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18262-1-AP targets PDK1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13121

Product name: Recombinant human PDK1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-436 aa of BC039158

Sequence: MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA

Predict reactive species
Full Name pyruvate dehydrogenase kinase, isozyme 1
Calculated Molecular Weight 436 aa, 49 kDa
Observed Molecular Weight 46-55 kDa
GenBank Accession NumberBC039158
Gene Symbol PDK1
Gene ID (NCBI) 5163
RRIDAB_10598310
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15118
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDK1(pyruvate dehydrogenase kinase isoform 1) is also named as PDHK1 and belongs to the PDK/BCKDK protein kinase family. It inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism (PMID:17683942). Starvation increases islet PDK activity (PMID:11723055). PDK1 has 2 isoforms with the MW of 49 and 52 kD, and a 28aa-transit-peptide in the N-terminal can be removed in the mature form. This antibody is specific to PDK1.

Protocols

Product Specific Protocols
IHC protocol for PDK1 antibody 18262-1-APDownload protocol
IP protocol for PDK1 antibody 18262-1-APDownload protocol
WB protocol for PDK1 antibody 18262-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human,mouseWB,IHC

J Clin Invest

PRMT5 mediated FUBP1 methylation accelerates prostate cancer progression

Authors - Weiwei Yan
mouseWB,IF

Cardiovasc Res

Inhibition of PGK1 attenuates autoimmune myocarditis by reprogramming CD4+ T cells metabolism

Authors - Yang Lu
mouseWB,IF

Cell Death Dis

Pyruvate dehydrogenase kinase 1 protects against neuronal injury and memory loss in mouse models of diabetes

Authors - Yuan Yao
mouseWB

Bioact Mater

Polydopamine-mediated graphene oxide and nanohydroxyapatite-incorporated conductive scaffold with an immunomodulatory ability accelerates periodontal bone regeneration in diabetes.

Authors - Yazhen Li
humanWB,IHC

Cancer Lett

PINK1 deficiency in gastric cancer compromises mitophagy, promotes the Warburg effect, and facilitates M2 polarization of macrophages.

Authors - Ying Xu
humanWB

Redox Biol

Impairment of Akt activity by CYP2E1 mediated oxidative stress is involved in chronic ethanol-induced fatty liver.

Authors - Tao Zeng
Loading...
||
New chat Able
正在加载,请稍候...