PFKFB3 Polyclonal antibody

• 

  WB analysis using 13763-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13763-1-AP (PFKFB3-Specific antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 13763-1-AP

  WB result of PFKFB3-Specific antibody (13763-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PFKFB3-Specific transfected HEK-293 cells.

• 

  WB analysis of mouse heart using 13763-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 13763-1-AP (PFKFB3-Specific antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 13763-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 13763-1-AP (PFKFB3-Specific antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 13763-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 13763-1-AP (PFKFB3-Specific antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse spleen using 13763-1-AP

  IP result of anti-PFKFB3 (IP:13763-1-AP, 4ug; Detection:13763-1-AP 1:500) with mouse spleen tissue lysate 2440 ug.

• 

  IP experiment of mouse spleen using 13763-1-AP

  IP result of anti-PFKFB3 (IP:13763-1-AP, 4ug; Detection:13763-1-AP 1:300) with mouse spleen tissue lysate 3920 ug.

• 

  IP experiment of mouse spleen using 13763-1-AP

  IP result of anti-PFKFB3 (IP:13763-1-AP, 4ug; Detection:13763-1-AP 1:300) with mouse spleen tissue lysate 3920 ug.

• 

  IHC staining of human stomach cancer using 13763-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 13763-1-AP (PFKFB3 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 13763-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 13763-1-AP (PFKFB3 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 13763-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 13763-1-AP (PFKFB3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 13763-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 13763-1-AP (PFKFB3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 13763-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 13763-1-AP (PFKFB3-Specific antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 13763-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 13763-1-AP (PFKFB3-Specific antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HepG2 using 13763-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using PFKFB3-Specific antibody (13763-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

PFKFB3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13763-1-AP

Publications(146)

Reviews (5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

PFKFB3-Specific, 6PF-2-K/Fru-2,6-P2ase 3, 6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme, 6-phosphofructo-2-kinase, 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse thymus tissue, mouse heart tissue, A431 cells, HeLa cells, Jurkat cells, mouse spleen tissue
• Positive IP detected in: mouse spleen tissue
• Positive IHC detected in: human stomach cancer tissue, human kidney tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 19 publications below
• WB: See 132 publications below
• IHC: See 31 publications below
• IF: See 21 publications below
• IP: See 4 publications below
• CoIP: See 2 publications below

Product Information

13763-1-AP targets PFKFB3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4744

  Product name: Recombinant human PFKFB3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 243-520 aa of BC040482

  Sequence: HVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH

• Full Name: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
• Calculated Molecular Weight: 520 aa, 60 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC040482
• Gene Symbol: PFKFB3
• Gene ID (NCBI): 5209
• RRID: AB_2162854
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16875
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PFKFB3, also named as NY-REN-56 and iPFK-2, plays a role in glucose metabolism. Its synthesis and degradation of fructose 2,6-bisphosphate. Endogenously generated adenosine cooperates with bacterial components to increase PFKFB3 isozyme activity, resulting in greater fructose 2,6-bisphosphate accumulation. PFKFB3 is required for increased growth, metabolic activity and is regulated through active JAK2 and STAT5.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; FGF-dependent metabolic control of vascular development.; Authors - Pengchun Yu
human	WB	Cell; Role of PFKFB3-Driven Glycolysis in Vessel Sprouting.; Authors - De Bock Katrien K
mouse	WB	Cell Metab; Acetate enables metabolic fitness and cognitive performance during sleep disruption; Authors - Qinqin He
human	WB	Cell Metab; CircACC1 Regulates Assembly and Activation of AMPK Complex under Metabolic Stress.; Authors - Qidong Li
human	WB,IP	Cell Metab; NEAT1 is essential for metabolic changes that promote breast cancer growth and metastasis.; Authors - Mi Kyung Park
mouse	WB	Circulation; Exercise-Induced Changes in Glucose Metabolism Promote Physiologic Cardiac Growth.; Authors - Andrew A Gibb

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Balawant (Verified Customer) (08-24-2022)

this antibody is working good for westerner blot.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: colon tissue and colon cancer cell line

FH

Balawant (Verified Customer) (05-08-2022)

tis antibody is working great at 1:2000 diluton. I have used this antibody from total cells lysate of colonic epithelial cells form human origin.

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: Colonic epithelial cells

FH

Iram (Verified Customer) (04-13-2022)

Very good signal

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: Colon cancer cells

FH

Susmita (Verified Customer) (03-11-2022)

This antibody works great for me.

• Applications: Western Blot
• Primary Antibody Dilution: WB: 1: 2000
• Cell Tissue Type: PC cell line

FH

Hsin-Sheng (Verified Customer) (08-19-2019)

Strong bend intensity at around 60 kD. However, there is a non-specific band near 65-70 kD.

• Applications: Western Blot,
• Primary Antibody Dilution: 1;200
• Cell Tissue Type: H1299