• Featured Product
  • KD/KO Validated

PFKFB3 Polyclonal antibody

PFKFB3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 13763-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

PFKFB3-Specific, 6PF-2-K/Fru-2,6-P2ase 3, 6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme, 6-phosphofructo-2-kinase, 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, mouse thymus tissue, mouse heart tissue, A431 cells, HeLa cells, Jurkat cells, mouse spleen tissue
Positive IP detected inmouse spleen tissue
Positive IHC detected inhuman stomach cancer tissue, human kidney tissue, human liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:300-1:1200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13763-1-AP targets PFKFB3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4744

Product name: Recombinant human PFKFB3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 243-520 aa of BC040482

Sequence: HVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH

Predict reactive species
Full Name 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
Calculated Molecular Weight 520 aa, 60 kDa
Observed Molecular Weight 58 kDa
GenBank Accession NumberBC040482
Gene Symbol PFKFB3
Gene ID (NCBI) 5209
RRIDAB_2162854
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16875
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PFKFB3, also named as NY-REN-56 and iPFK-2, plays a role in glucose metabolism. Its synthesis and degradation of fructose 2,6-bisphosphate. Endogenously generated adenosine cooperates with bacterial components to increase PFKFB3 isozyme activity, resulting in greater fructose 2,6-bisphosphate accumulation. PFKFB3 is required for increased growth, metabolic activity and is regulated through active JAK2 and STAT5.

Protocols

Product Specific Protocols
IF protocol for PFKFB3 antibody 13763-1-APDownload protocol
IHC protocol for PFKFB3 antibody 13763-1-APDownload protocol
IP protocol for PFKFB3 antibody 13763-1-APDownload protocol
WB protocol for PFKFB3 antibody 13763-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nature

FGF-dependent metabolic control of vascular development.

Authors - Pengchun Yu
humanWB

Cell

Role of PFKFB3-Driven Glycolysis in Vessel Sprouting.

Authors - De Bock Katrien K
mouseWB

Cell Metab

Acetate enables metabolic fitness and cognitive performance during sleep disruption

Authors - Qinqin He
humanWB

Cell Metab

CircACC1 Regulates Assembly and Activation of AMPK Complex under Metabolic Stress.

Authors - Qidong Li
humanWB,IP

Cell Metab

NEAT1 is essential for metabolic changes that promote breast cancer growth and metastasis.

Authors - Mi Kyung Park
mouseWB

Circulation

Exercise-Induced Changes in Glucose Metabolism Promote Physiologic Cardiac Growth.

Authors - Andrew A Gibb

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Balawant (Verified Customer) (08-24-2022)

this antibody is working good for westerner blot.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: colon tissue and colon cancer cell line
FH

Balawant (Verified Customer) (05-08-2022)

tis antibody is working great at 1:2000 diluton. I have used this antibody from total cells lysate of colonic epithelial cells form human origin.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Colonic epithelial cells
FH

Iram (Verified Customer) (04-13-2022)

Very good signal

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Colon cancer cells
FH

Susmita (Verified Customer) (03-11-2022)

This antibody works great for me.

  • Applications: Western Blot
  • Primary Antibody Dilution: WB: 1: 2000
  • Cell Tissue Type: PC cell line
FH

Hsin-Sheng (Verified Customer) (08-19-2019)

Strong bend intensity at around 60 kD. However, there is a non-specific band near 65-70 kD.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1;200
  • Cell Tissue Type: H1299
Loading...
||
New chat Able
正在加载,请稍候...