Tested Applications
Positive WB detected in | mouse kidney tissue, mouse pancreas tissue, rat kidney tissue |
Positive IP detected in | mouse kidney tissue |
Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 18 publications below |
IHC | See 6 publications below |
IF | See 11 publications below |
Product Information
10147-1-AP targets t-Plasminogen activator/tPA in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0200 Product name: Recombinant human PLAT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 359-516 aa of BC002795 Sequence: NDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP Predict reactive species |
Full Name | plasminogen activator, tissue |
Calculated Molecular Weight | 57 kDa |
Observed Molecular Weight | 32-35 kDa, 65 kDa |
GenBank Accession Number | BC002795 |
Gene Symbol | tPA |
Gene ID (NCBI) | 5327 |
RRID | AB_2299701 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P00750 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Plasminogen activator, tissue (PLAT, synonyms: TPA, T-PA) is a tissue-type plasminogen activator, a secreted serine protease which converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. Tissue-type plasminogen activator is synthesized as a single chain which is cleaved by plasmin to a two chain disulfide linked protein (33 kDa and 32 kDa). PLAT enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding; decreased activity leads to hypofibrinolysis which can result in thrombosis or embolism. tPA has 4 isoforms produced by alternative splicing with the MW of 63 kDa, 33 kDa, 57 kDa and 44 kDa.
Protocols
Product Specific Protocols | |
---|---|
IF protocol for t-Plasminogen activator/tPA antibody 10147-1-AP | Download protocol |
IHC protocol for t-Plasminogen activator/tPA antibody 10147-1-AP | Download protocol |
IP protocol for t-Plasminogen activator/tPA antibody 10147-1-AP | Download protocol |
WB protocol for t-Plasminogen activator/tPA antibody 10147-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Acta Neuropathol TAM receptors mediate the Fpr2-driven pain resolution and fibrinolysis after nerve injury | ||
Redox Biol FUNDC1-dependent mitophagy induced by tPA protects neurons against cerebral ischemia-reperfusion injury.
| ||
J Neurosci Tissue plasminogen activator contributes to alterations of neuronal migration and activity-dependent responses in fragile x mice. | ||
Aging (Albany NY) NFAT5 directs hyperosmotic stress-induced fibrin deposition and macrophage infiltration via PAI-1 in endothelium. | ||
Glia Lipoprotein receptor loss in forebrain radial glia results in neurological deficits and severe seizures. | ||
Sci Rep Development of a Biomimetic Chondroitin Sulfate-modified Hydrogel to Enhance the Metastasis of Tumor Cells. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH nuo (Verified Customer) (08-22-2021) | There is a band at around 64 kD as expected, although there were other nonspecific bindings.
![]() |