Tested Applications
Positive WB detected in | HeLa cells, U2OS cells, HEK-293 cells, Caco-2 cells, MCF-7 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells, LNCaP cells |
Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | human liver cancer tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 4 publications below |
IF | See 2 publications below |
IP | See 1 publications below |
CoIP | See 1 publications below |
Product Information
66820-1-Ig targets PRDX1 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag8821 Product name: Recombinant human PRDX1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-199 aa of BC007063 Sequence: MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK Predict reactive species |
Full Name | peroxiredoxin 1 |
Calculated Molecular Weight | 199 aa, 22 kDa |
Observed Molecular Weight | 23 kDa |
GenBank Accession Number | BC007063 |
Gene Symbol | PRDX1 |
Gene ID (NCBI) | 5052 |
RRID | AB_2882163 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q06830 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PRDX1(Peroxiredoxin-1), also named as PAGA, PAGB, TDPX2, PAG or NKEF-A, belongs to the ahpC/TSA family. PRDX1 is a thiol reductase that plays critical roles in oxidative and thermal stress defense mechanisms through its abilities to metabolize H2O2 and act as a molecular chaperone, respectively. PRDX1 might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2 ((PMID: 9497357)). It reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation. PRDX1 can form a dimer, and also can be phosphorylated on Thr-90 during the M-phase, which leads to a more than 80% decrease in enzymatic activity (PMID: 22583657, 11986303).
Protocols
Product Specific Protocols | |
---|---|
IF protocol for PRDX1 antibody 66820-1-Ig | Download protocol |
IHC protocol for PRDX1 antibody 66820-1-Ig | Download protocol |
WB protocol for PRDX1 antibody 66820-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Virol Peroxiredoxin 1 interacts with TBK1/IKKε and negatively regulates pseudorabies virus propagation by promoting innate immunity. | ||
Vet Microbiol Inhibition of pseudorabies virus replication via upregulated interferon response by targeting 7-dehydrocholesterol reductase | ||
Front Immunol Chaihushugan powder regulates the gut microbiota to alleviate mitochondrial oxidative stress in the gastric tissues of rats with functional dyspepsia | ||
Antioxidants (Basel) Garlic-Derived Metabolites Exert Antioxidant Activity, Modulate Gut Microbiota Composition and Limit Citrobacter rodentium Infection in Mice | ||
Heliyon EEF1A2 accelerates the protein translation of chemokine in rat myocardial cells induced by ischemia-reperfusion | ||
Mol Neurobiol PRDX1 Interfering Peptide Disrupts Amino Acids 70-90 of PRDX1 to Inhibit the TLR4/NF-κB Signaling Pathway and Attenuate Neuroinflammation and Ischemic Brain Injury |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH PILAR (Verified Customer) (08-24-2023) | Excellent customer service and fast shipment. Waiting for the experiment results!
|