Tested Applications
| Positive WB detected in | HeLa cells, U2OS cells, HEK-293 cells, Caco-2 cells, MCF-7 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells, LNCaP cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human liver cancer tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IF | See 2 publications below |
| IP | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
66820-1-Ig targets PRDX1 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8821 Product name: Recombinant human PRDX1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-199 aa of BC007063 Sequence: MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK Predict reactive species |
| Full Name | peroxiredoxin 1 |
| Calculated Molecular Weight | 199 aa, 22 kDa |
| Observed Molecular Weight | 23 kDa |
| GenBank Accession Number | BC007063 |
| Gene Symbol | PRDX1 |
| Gene ID (NCBI) | 5052 |
| RRID | AB_2882163 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q06830 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PRDX1(Peroxiredoxin-1), also named as PAGA, PAGB, TDPX2, PAG or NKEF-A, belongs to the ahpC/TSA family. PRDX1 is a thiol reductase that plays critical roles in oxidative and thermal stress defense mechanisms through its abilities to metabolize H2O2 and act as a molecular chaperone, respectively. PRDX1 might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2 ((PMID: 9497357)). It reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation. PRDX1 can form a dimer, and also can be phosphorylated on Thr-90 during the M-phase, which leads to a more than 80% decrease in enzymatic activity (PMID: 22583657, 11986303).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PRDX1 antibody 66820-1-Ig | Download protocol |
| IHC protocol for PRDX1 antibody 66820-1-Ig | Download protocol |
| WB protocol for PRDX1 antibody 66820-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Virol Peroxiredoxin 1 interacts with TBK1/IKKε and negatively regulates pseudorabies virus propagation by promoting innate immunity. | ||
Vet Microbiol Inhibition of pseudorabies virus replication via upregulated interferon response by targeting 7-dehydrocholesterol reductase | ||
Front Immunol Multi-omics dissection of fatty acid metabolism heterogeneity identifies PRDX1 as a prognostic marker in bladder cancer | ||
Heliyon EEF1A2 accelerates the protein translation of chemokine in rat myocardial cells induced by ischemia-reperfusion | ||
Mol Neurobiol PRDX1 Interfering Peptide Disrupts Amino Acids 70-90 of PRDX1 to Inhibit the TLR4/NF-κB Signaling Pathway and Attenuate Neuroinflammation and Ischemic Brain Injury | ||
Antioxidants (Basel) Garlic-Derived Metabolites Exert Antioxidant Activity, Modulate Gut Microbiota Composition and Limit Citrobacter rodentium Infection in Mice |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH PILAR (Verified Customer) (08-24-2023) | Excellent customer service and fast shipment. Waiting for the experiment results!
|













