• Featured Product
  • KD/KO Validated

PRDX1 Monoclonal antibody, PBS Only

PRDX1 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 66820-1-PBS
Clone No.2B2A2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

2B2A2, EC:1.11.1.24, MSP23, Natural killer cell-enhancing factor A, NKEF-A

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66820-1-PBS targets PRDX1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8821

Product name: Recombinant human PRDX1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-199 aa of BC007063

Sequence: MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Predict reactive species
Full Name peroxiredoxin 1
Calculated Molecular Weight 199 aa, 22 kDa
Observed Molecular Weight 23 kDa
GenBank Accession NumberBC007063
Gene Symbol PRDX1
Gene ID (NCBI) 5052
RRIDAB_2882163
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ06830
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PRDX1(Peroxiredoxin-1), also named as PAGA, PAGB, TDPX2, PAG or NKEF-A, belongs to the ahpC/TSA family. PRDX1 is a thiol reductase that plays critical roles in oxidative and thermal stress defense mechanisms through its abilities to metabolize H2O2 and act as a molecular chaperone, respectively. PRDX1 might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2 ((PMID: 9497357)). It reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation. PRDX1 can form a dimer, and also can be phosphorylated on Thr-90 during the M-phase, which leads to a more than 80% decrease in enzymatic activity (PMID: 22583657, 11986303).

Loading...
||
New chat

Able

正在加载,请稍候...