Tested Applications
| Positive WB detected in | HepG2 cells, C2C12 cells, PC-12 cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human liver tissue, human hepatocirrhosis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:600-1:3000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 5 publications below |
| WB | See 44 publications below |
| IHC | See 12 publications below |
| IF | See 8 publications below |
| IP | See 3 publications below |
| CoIP | See 1 publications below |
| RIP | See 1 publications below |
Product Information
10545-2-AP targets Peroxiredoxin 2 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0835 Product name: Recombinant human PRDX2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-198 aa of BC003022 Sequence: MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN Predict reactive species |
| Full Name | peroxiredoxin 2 |
| Calculated Molecular Weight | 22 kDa |
| Observed Molecular Weight | 22 kDa |
| GenBank Accession Number | BC003022 |
| Gene Symbol | peroxiredoxin 2 |
| Gene ID (NCBI) | 7001 |
| RRID | AB_2168202 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P32119 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PRDX2, also named as TSA, PRP, NKEFB and TDPX1, belongs to the ahpC/TSA family. It is known to act as an antioxidant enzyme whose main function is H2O2 reduction in cells. PRDX2 is involved in redox regulation of the cell. It reduces peroxides with reducing equivalents provided through the thioredoxin system. It may play an important role in eliminating peroxides generated during metabolism. PRDX2 might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2. PRDX2 actions may be related to the expression of NFKB and IKB.(PMID:21248284)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Peroxiredoxin 2 antibody 10545-2-AP | Download protocol |
| IF protocol for Peroxiredoxin 2 antibody 10545-2-AP | Download protocol |
| IHC protocol for Peroxiredoxin 2 antibody 10545-2-AP | Download protocol |
| IP protocol for Peroxiredoxin 2 antibody 10545-2-AP | Download protocol |
| WB protocol for Peroxiredoxin 2 antibody 10545-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
ACS Nano Engineering Extracellular Vesicles Restore the Impaired Cellular Uptake and Attenuate Intervertebral Disc Degeneration. | ||
Clin Transl Med PINK1 modulates Prdx2 to reduce lipotoxicity-induced apoptosis and attenuate cardiac dysfunction in heart failure mice with a preserved ejection fraction | ||
Angiogenesis Endothelial USP11 drives VEGFR2 signaling and angiogenesis via PRDX2/c-MYC axis | ||
Br J Pharmacol Luteolin ameliorates rat myocardial ischemia-reperfusion injury through peroxiredoxin II activation. | ||
Free Radic Biol Med Oxidation resistance 1 regulates post-translational modifications of peroxiredoxin 2 in the cerebellum. |



















