• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Peroxiredoxin 2 Polyclonal antibody

Peroxiredoxin 2 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-10545

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

PRDX2, EC:1.11.1.24, Natural killer cell-enhancing factor B, NKEFB, NKEF-B

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10545 targets Peroxiredoxin 2 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0835

Product name: Recombinant human PRDX2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-198 aa of BC003022

Sequence: MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Predict reactive species
Full Name peroxiredoxin 2
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC003022
Gene Symbol peroxiredoxin 2
Gene ID (NCBI) 7001
RRIDAB_3672450
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDP32119
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PRDX2, also named as TSA, PRP, NKEFB and TDPX1, belongs to the ahpC/TSA family. It is known to act as an antioxidant enzyme whose main function is H2O2 reduction in cells. PRDX2 is involved in redox regulation of the cell. It reduces peroxides with reducing equivalents provided through the thioredoxin system. It may play an important role in eliminating peroxides generated during metabolism. PRDX2 might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2. PRDX2 actions may be related to the expression of NFKB and IKB.(PMID:21248284)

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Peroxiredoxin 2 antibody CL488-10545Download protocol
IF protocol for CL Plus 488 Peroxiredoxin 2 antibody CL488-10545Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...