Tested Applications
| Positive WB detected in | A375 cells, HepG2 cells, HEK-293 cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human colon cancer tissue, human pancreas cancer tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10703-1-AP targets PRDX4 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1177 Product name: Recombinant human PRDX4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-271 aa of BC007107 Sequence: MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN Predict reactive species |
| Full Name | peroxiredoxin 4 |
| Calculated Molecular Weight | 31 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC007107 |
| Gene Symbol | PRDX4 |
| Gene ID (NCBI) | 10549 |
| RRID | AB_2168493 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13162 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PRDX4 (Peroxiredoxin-4) is also named as AOE37-2, Prx-IV and belongs to the AhpC/TSA family. PRDX4 is associated with acrosome formation during rat spermatogenesis and has a protective role in the male reproductive tract, because the phenotype of mice lacking this isoform includes testicular atrophy and increased sperm DNA damage (PMID:20864641). It is initially synthesized as a membrane-binding 31-kDa protein and processed into a 27-kDa secretory form and is discarded with the residual bodies (PMID:19208552). PRDX4 is a pentamer of dimers (PMID:23025503). This antibody is specific to PRDX4.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for PRDX4 antibody 10703-1-AP | Download protocol |
| IF protocol for PRDX4 antibody 10703-1-AP | Download protocol |
| IHC protocol for PRDX4 antibody 10703-1-AP | Download protocol |
| IP protocol for PRDX4 antibody 10703-1-AP | Download protocol |
| WB protocol for PRDX4 antibody 10703-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Catalog #10703-1-AP (anti-Peroxiredoxin antibody) has 32 citations. Journals include Nature Communications, Science Advances, Cell Chemical Biology, Cell Reports, Journal of Biological Chemistry, FEBS Journal, Antioxidants & Redox Signaling, and others. Research fields span oxidative stress, cancer (myeloma, esophageal, prostate, pancreatic, glioblastoma), sepsis, NASH, diabetic retinopathy, rheumatoid arthritis, multiple sclerosis, cardiac injury, ER stress, ferroptosis, and redox signaling.
| Species | Application | Title |
|---|---|---|
Exploration (Beijing) Targeting eEF1A1 With Baicalein to Block eEF1A1/Prdx4 Interaction for Treating Sepsis-Mediated Lung Injury | ||
Nat Commun Inhibited peroxidase activity of peroxiredoxin 1 by palmitic acid exacerbates nonalcoholic steatohepatitis in male mice | ||
Nat Commun Lipopolysaccharide binding protein resists hepatic oxidative stress by regulating lipid droplet homeostasis | ||
Nat Commun The deubiquitinase OTUD1 regulates immunoglobulin production and proteasome inhibitor sensitivity in multiple myeloma | ||
Sci Adv H2S-Prdx4 axis mitigates Golgi stress to bolster tumor-reactive T cell immunotherapeutic response
| ||
