• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated PRDX4 Polyclonal antibody

PRDX4 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL647-10703

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Antioxidant enzyme AOE372, AOE37 2, AOE37-2, EC:1.11.1.24, peroxiredoxin 4

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-10703 targets PRDX4 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1177

Product name: Recombinant human PRDX4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-271 aa of BC007107

Sequence: MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

Predict reactive species
Full Name peroxiredoxin 4
Calculated Molecular Weight 31 kDa
Observed Molecular Weight 30 kDa
GenBank Accession NumberBC007107
Gene Symbol PRDX4
Gene ID (NCBI) 10549
RRIDAB_2934831
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13162
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PRDX4 (Peroxiredoxin-4) is also named as AOE37-2, Prx-IV and belongs to the AhpC/TSA family. PRDX4 is associated with acrosome formation during rat spermatogenesis and has a protective role in the male reproductive tract, because the phenotype of mice lacking this isoform includes testicular atrophy and increased sperm DNA damage (PMID:20864641). It is initially synthesized as a membrane-binding 31-kDa protein and processed into a 27-kDa secretory form and is discarded with the residual bodies (PMID:19208552). PRDX4 is a pentamer of dimers (PMID:23025503). This antibody is specific to PRDX4.

Protocols

Product Specific Protocols
IF protocol for CL Plus 647 PRDX4 antibody CL647-10703Download protocol
FC protocol for CL Plus 647 PRDX4 antibody CL647-10703Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...