PRKG1 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 85983-1-RR (same clone as 85983-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85983-1-RR (PRKG1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85983-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP02943-1

  The mean PRKG1 concentration was determined to be 15.3 ng/mL in Rat lung tissue extract based on a 4.8 mg/mL extract load, Rat brain tissue extract were served as a negative control.

• 

  Cytometric bead array standard curve of MP02943-1

  Cytometric bead array standard curve of MP02943-1, PRKG1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85983-1-PBS. Detection antibody: 85983-2-PBS. Standard: Ag16333. Range: 0.625-80 ng/mL.

• 

  Affinity and Kinetic Characterization of 85983-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85983-1-RR against Human PRKG1 were performed. The affinity constant is below 1 pM.

PRKG1 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 85983-1-PBS

Clone No.250348B5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

CGKI, cGK1, cGMP-dependent protein kinase 1, cGMP-dependent protein kinase I, EC:2.7.11.12

---

Product Information

85983-1-PBS targets PRKG1 as part of a matched antibody pair:

MP02943-1: 85983-1-PBS capture and 85983-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag16333

  Product name: Recombinant human PRKG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-178 aa of BC127090

  Sequence: MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPG

• Full Name: protein kinase, cGMP-dependent, type I
• Calculated Molecular Weight: 686 aa, 78 kDa
• Observed Molecular Weight: 65-78 kDa
• GenBank Accession Number: BC127090
• Gene Symbol: PRKG1
• Gene ID (NCBI): 5592
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13976
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PRKG1(cGMP-dependent protein kinase 1) is also named as cGK1, PRKG1B, PRKGR1A, PRKGR1B and belongs to the cGMP subfamily. It serves as an integral component of second messenger signaling in a number of biological contexts including cell differentiation, memory, and vasodilation (PMID:21893290). Its activity prevents pathological-level nitric oxide-induced apoptosis and promotes DNA synthesis/cell proliferation in vascular smooth muscle cells (PMID:20060325). PRKG1 has 2 isoforms produced by alternative splicing with the molecular weight of 76 kDa and 78 kDa. The autophosphorylation can increase the kinase activity and it can form a monomer with the molecular weight of 65 kDa that is produced by proteolytic cleavage. SDS-PAGE revealed that proteolysis generated two different monomers with molecular masses of 70 and 68 kDa of CGK1-beta(PMID:8702828).