PRKG1 Recombinant monoclonal antibody

PRKG1 Uni-rAb® Recombinant Antibody for WB, ELISA

Cat No. 85983-1-RR
Clone No.250348B5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

CGKI, cGK1, cGMP-dependent protein kinase 1, cGMP-dependent protein kinase I, EC:2.7.11.12

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue, mouse lung tissue, rat lung tissue, mouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85983-1-RR targets PRKG1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag16333

Product name: Recombinant human PRKG1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-178 aa of BC127090

Sequence: MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPG

Predict reactive species
Full Name protein kinase, cGMP-dependent, type I
Calculated Molecular Weight 686 aa, 78 kDa
Observed Molecular Weight 65-78 kDa
GenBank Accession NumberBC127090
Gene Symbol PRKG1
Gene ID (NCBI) 5592
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13976
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRKG1(cGMP-dependent protein kinase 1) is also named as cGK1, PRKG1B, PRKGR1A, PRKGR1B and belongs to the cGMP subfamily. It serves as an integral component of second messenger signaling in a number of biological contexts including cell differentiation, memory, and vasodilation (PMID:21893290). Its activity prevents pathological-level nitric oxide-induced apoptosis and promotes DNA synthesis/cell proliferation in vascular smooth muscle cells (PMID:20060325). PRKG1 has 2 isoforms produced by alternative splicing with the molecular weight of 76 kDa and 78 kDa. The autophosphorylation can increase the kinase activity and it can form a monomer with the molecular weight of 65 kDa that is produced by proteolytic cleavage. SDS-PAGE revealed that proteolysis generated two different monomers with molecular masses of 70 and 68 kDa of CGK1-beta(PMID:8702828).

Protocols

Product Specific Protocols
WB protocol for PRKG1 antibody 85983-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...