Recombinant human PSMG2 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag1400
Synonyms
CLAST3; HCCA3; HsT1707; MDS003; MGC15092; PAC2; TNFSF5IP1
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MFVPCGESAPDLAGFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNPYATTEGNSTELSINAEVYSLPSRKLVALQLRSIFIKYKSKPFCEKLLSWVKSSGCARVIVLSSSHSYQRNDLQLRSTPFRYLLTPSMQKSVQNKIKSLNWEEMEKSRCIPEIDDSEFCIRIPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDALGLVEYLNEWLQILKPLSDDPTVSASRWKIPSSWRLLFGSGLPPALF
(1-264 aa encoded by BC013356) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
