PTPN1/PTP1B Polyclonal antibody

• 

  WB analysis of Sp2/0 using 11334-1-AP

  Sp2/0 cells were subjected to SDS PAGE followed by western blot with 11334-1-AP (PTP1B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 11334-1-AP

  WB result of PTP1B antibody (11334-1-AP; 1:30000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PTP1B transfected Jurkat cells.

• 

  WB analysis using 11334-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11334-1-AP (PTP1B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11334-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11334-1-AP (PTP1B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of THP-1 using 11334-1-AP

  THP-1 cells were subjected to SDS PAGE followed by western blot with 11334-1-AP (PTP1B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11334-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11334-1-AP (PTP1B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of A431 using 11334-1-AP

  IP result of anti-PTP1B (IP:11334-1-AP, 4ug; Detection:11334-1-AP 1:500) with A431 cells lysate 2400ug.

• 

  IHC staining of mouse placenta using 11334-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 11334-1-AP (PTPN1/PTP1B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse placenta using 11334-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 11334-1-AP (PTPN1/PTP1B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of BxPC-3 using 11334-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed BxPC-3 cells using PTP1B antibody (11334-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

• Featured Product
• KD/KO Validated

PTPN1/PTP1B Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11334-1-AP

Publications(41)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

PTP1B, PTPN1, EC:3.1.3.48, Protein-tyrosine phosphatase 1B, PTP 1B

---

Tested Applications

• Positive WB detected in: Sp2/0 cells, HeLa cells, mouse liver tissue, THP-1 cells, Jurkat cells, C6 cells, NIH/3T3 cells, rat liver tissue, mouse placenta tissue
• Positive IP detected in: A431 cells
• Positive IHC detected in: mouse placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: BxPC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 8 publications below
• WB: See 38 publications below
• IHC: See 9 publications below
• IF: See 6 publications below
• IP: See 2 publications below
• CoIP: See 2 publications below

Product Information

11334-1-AP targets PTPN1/PTP1B in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1878

  Product name: Recombinant human PTPN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-435 aa of BC015660

  Sequence: MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT

• Full Name: protein tyrosine phosphatase, non-receptor type 1
• Calculated Molecular Weight: 435 aa, 50 kDa
• Observed Molecular Weight: 45-55 kDa
• GenBank Accession Number: BC015660
• Gene Symbol: PTP1B
• Gene ID (NCBI): 5770
• RRID: AB_10642566
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P18031
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTPN1 (protein tyrosine phosphatase, non-receptor type 1) is also named as PTP1B or PTP-1B, and belongs to the protein-tyrosine phosphatase family and non-receptor class 1 subfamily. PTPN1 is involved in the regulation of several important physiological pathways, which regulates both INS and leptin signaling, and interacts with the epidermal-and platelet-derived growth factor receptors (PMID: 20101100). The gene might harbor variants influencing susceptibility to INS resistance and type 2 diabetes (PMID:15919813). The molecular mass of PTPN1 is 50 kDa, but sometimes some truncated forms can be detected as 48, 46, 39, 37 kDa due to non-specific proteolytic cleavage of PTP1B in different cells (PMID: 18253097).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	J Ginseng Res; Ginsenoside compound K reduces ischemia/reperfusion-induced neuronal apoptosis by inhibiting PTP1B-mediated IRS1 tyrosine dephosphorylation; Authors - Jing Fu
human	WB	Aging (Albany NY); Glycochenodeoxycholic acid induces stemness and chemoresistance via the STAT3 signaling pathway in hepatocellular carcinoma cells.; Authors - Changying Shi
rat	WB	J Cell Physiol; Circular RNA circTET3 mediates migration of rat vascular smooth muscle cells by targeting miR-351-5p.; Authors - Qing-Ping Yao
mouse	WB,IHC	FASEB J; PMID: 32100381; Authors - Ping Yang
human	WB	Front Cell Dev Biol; Tubeimoside I Inhibits Cell Proliferation and Induces a Partly Disrupted and Cytoprotective Autophagy Through Rapidly Hyperactivation of MEK1/2-ERK1/2 Cascade via Promoting PTP1B in Melanoma.; Authors - Juan Du ; KD Validated
mouse	WB	Eur J Pharmacol; Oleanolic acid derivative alleviates cardiac fibrosis through inhibiting PTP1B activity and regulating AMPK/TGF-β/Smads pathway; Authors - An-Hui Wang