RADIL Polyclonal antibody

• 

  WB analysis using 20284-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20284-1-AP (RADIL antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 20284-1-AP

  IP result of anti-RADIL (IP:20284-1-AP, 4ug; Detection:20284-1-AP 1:1000) with HEK-293 cells lysate 1400 ug.

• Featured Product
• KD/KO Validated

RADIL Polyclonal Antibody for WB, IP, ELISA

Cat No. 20284-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, ELISA

Synonyms

KIAA1849, Ras-associating and dilute domain-containing protein

---

Tested Applications

• Positive WB detected in: HEK-293 cells, SH-SY5Y cells, mouse testis tissue
• Positive IP detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below

Product Information

20284-1-AP targets RADIL in WB, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13996

  Product name: Recombinant human RADIL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 776-1075 aa of BC004919

  Sequence: IVLPSDGFQVDLEANCLDDSIYQHLLYVRHFLWGLRSRASPGSPGRPGSGASQPVCPEGMHHVVLDGHLEAPSCPLAPRDPGPAAREVAPERTLPLRGAPWAQAPPGRQPGRGGSQAGPPHTDSSCLLTPPSTPLGPEPGDPDWPESGGPCGKALPERQRNGPSGLRGAAPEGDSAALAEESPPAPSSRSSSTEDFCYVFTVELERGPSGLGMGLIDGMHTHLGAPGLYIQTLLPGSPAAADGRLSLGDRILEVNGSSLLGLGYLRAVDLIRHGGKKMRFLVAKSDVETAKKIHFRTPPL

• Full Name: Ras association and DIL domains
• Calculated Molecular Weight: 1075 aa, 117 kDa
• Observed Molecular Weight: 117 kDa
• GenBank Accession Number: BC004919
• Gene Symbol: RADIL
• Gene ID (NCBI): 55698
• RRID: AB_10732684
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96JH8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Radil is a broadly expressed adapter protein that contains a RA-like domain, a PDZ domain and a DIL domain. Like RAPL and RIAM, Radil interacts preferentially with active GTP-bound Rap1, and overexpression of Radil enhances integrin-mediated adhesion. In addition, Radil knockdown inhibits cell-substrate adhesion in HT1080, AD293, and NMuMG cells and results in migration defects in SW1353 and zebrafish neural crest cells (PMID: 17704304). Radil regulates neutrophil adhesion by specifically enhancing β2-integrin activation, as well as focal adhesion kinase (FAK) and paxillin phosphorylation (PMID: 23097489).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancers (Basel); Proteomic Mapping of the Interactome of KRAS Mutants Identifies New Features of RAS Signalling Networks and the Mechanism of Action of Sotorasib; Authors - Aoife Nolan
human	WB	J Biol Chem; Identification of Radil as a Ras binding partner and putative activator.; Authors - Byeong Hyeok Choi ; KD Validated