Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

TNFSF11/RANKL Monoclonal antibody

TNFSF11/RANKL Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 66610-1-Ig
Clone No.3F2E1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

TNFSF11, 3F2E1, CD 254, CD254, Receptor activator of nuclear factor kappa-B ligand

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCOLO 320 cells, HeLa cells, U2OS cells, HUVEC cells, NCCIT cells, human spleen tissue, DC2.4 cells, JAR cells, RAW 264.7 cells
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66610-1-Ig targets TNFSF11/RANKL in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19975

Product name: Recombinant human RANKL protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 76-317 aa of BC074890

Sequence: PNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

Predict reactive species
Full Name tumor necrosis factor (ligand) superfamily, member 11
Calculated Molecular Weight 317 aa, 35 kDa
Observed Molecular Weight 35-38 kDa
GenBank Accession NumberBC074890
Gene Symbol RANKL
Gene ID (NCBI) 8600
RRIDAB_2881970
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO14788
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TNFSF11 also known as RANKL, is a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. RANKL is a polypeptide of 217 amino acids that exerts its biological activity both in a transmembrane form of about 40-45 kDa and in soluble one of 31 kDa (PMID: 15308315). The membrane-bound RANKL (mRANKL) is cleaved into a sRANKL by the metalloprotease-disintegrin TNF-alpha convertase (TACE) or a related metalloprotease (MP). RANKL induces osteoclast formation through its receptor, RANK, which transduces signals by recruiting adaptor molecules, such as the TNF receptor-associated factor (TRAF) family of proteins. RANKL was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. RANKL was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis.

Protocols

Product Specific Protocols
IF protocol for TNFSF11/RANKL antibody 66610-1-IgDownload protocol
WB protocol for TNFSF11/RANKL antibody 66610-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC

J Cancer

Gut microbiota deficiency ameliorates multiple myeloma and myeloma-related bone disease by Th17 cells in mice models

Authors - Jia Liu
ratWB,IF

Folia Histochem Cytobiol

Platelet-rich plasma ameliorates cartilage degradation in rat models of osteoarthritis via the OPG/RANKL/RANK system

Authors - Qun Wu
mouseWB,IHC,IF

Open Life Sci

Effect of periostin on bone metabolic and autophagy factors during tooth eruption in mice

Authors - Han Qin
humanWB,IF

Cell Death Dis

RANK promotes colorectal cancer migration and invasion by activating the Ca2+-calcineurin/NFATC1-ACP5 axis.

Authors - Qian Liang
mouseIF

Adv Healthc Mater

Structured Polymers Enable the Sustained Delivery of Glucocorticoids within the Intra-Articular Space

Authors - Ana Crastin
mouseWB,IHC

Sci Rep

Black tea rich in polygonatum sibiricum polysaccharides inhibits osteoporosis in ovariectomized mice through immune regulation and gut microbiota suppression.

Authors - Shiyu Gao
Loading...
||
New chat

Able

正在加载,请稍候...