TNFSF11/RANKL Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 66610-1-Ig (same clone as 66610-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66610-1-Ig (RANKL antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66610-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66610-1-Ig (same clone as 66610-1-PBS)

  WB result of RANKL antibody (66610-1-Ig; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RANKL transfected HeLa cells. This data was developed using the same antibody clone with 66610-1-PBS in a different storage buffer formulation.

• 

  WB analysis of DC2.4 using 66610-1-Ig (same clone as 66610-1-PBS)

  DC2.4 cells were subjected to SDS PAGE followed by western blot with 66610-1-Ig (RANKL antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66610-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66610-1-Ig (same clone as 66610-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66610-1-Ig (RANKL antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66610-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U2OS using 66610-1-Ig (same clone as 66610-1-PBS)

  U2OS cells were subjected to SDS PAGE followed by western blot with 66610-1-Ig (RANKL antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66610-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HUVEC using 66610-1-Ig (same clone as 66610-1-PBS)

  HUVEC cells were subjected to SDS PAGE followed by western blot with 66610-1-Ig (RANKL antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66610-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NCCIT using 66610-1-Ig (same clone as 66610-1-PBS)

  NCCIT cell were subjected to SDS PAGE followed by western blot with 66610-1-Ig (RANKL antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66610-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human spleen using 66610-1-Ig (same clone as 66610-1-PBS)

  human spleen tissue were subjected to SDS PAGE followed by western blot with 66610-1-Ig (RANKL antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66610-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 66610-1-Ig (same clone as 66610-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using RANKL antibody (66610-1-Ig, Clone: 3F2E1 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66610-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP50526-1

  Cytometric bead array standard curve of MP50526-1, RANKL Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66610-1-PBS. Detection antibody: 66610-2-PBS. Standard:Ag19975. Range: 1.563-100 ng/mL.

• Featured Product
• KD/KO Validated

TNFSF11/RANKL Monoclonal Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 66610-1-PBS

Clone No.3F2E1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

TNFSF11, 3F2E1, CD 254, CD254, Receptor activator of nuclear factor kappa-B ligand

---

Product Information

66610-1-PBS targets TNFSF11/RANKL as part of a matched antibody pair:

MP50526-1: 66610-1-PBS capture and 66610-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19975

  Product name: Recombinant human RANKL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 76-317 aa of BC074890

  Sequence: PNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

• Full Name: tumor necrosis factor (ligand) superfamily, member 11
• Calculated Molecular Weight: 317 aa, 35 kDa
• Observed Molecular Weight: 35-38 kDa
• GenBank Accession Number: BC074890
• Gene Symbol: RANKL
• Gene ID (NCBI): 8600
• RRID: AB_2881970
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O14788
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TNFSF11 also known as RANKL, is a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. RANKL is a polypeptide of 217 amino acids that exerts its biological activity both in a transmembrane form of about 40-45 kDa and in soluble one of 31 kDa (PMID: 15308315). The membrane-bound RANKL (mRANKL) is cleaved into a sRANKL by the metalloprotease-disintegrin TNF-alpha convertase (TACE) or a related metalloprotease (MP). RANKL induces osteoclast formation through its receptor, RANK, which transduces signals by recruiting adaptor molecules, such as the TNF receptor-associated factor (TRAF) family of proteins. RANKL was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. RANKL was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis.