• Featured Product
  • KD/KO Validated

RHOA Polyclonal antibody

RHOA Polyclonal Antibody for WB, IF/ICC, IP, ELISA
Cat No. 10749-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

ARH12, ARHA, RHO12, EC:3.6.5.2, h12

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, MCF-7 cells, rat brain tissue, PC-12 cells, HL-60 cells, mouse brain tissue, HUVEC cells, NIH/3T3 cells, fetal human brain tissue
Positive IP detected inmouse brain tissue
Positive IF/ICC detected inHeLa cells, K-562 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10749-1-AP targets RHOA in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, canine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1141

Product name: Recombinant human RHOA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-193 aa of BC005976

Sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL

Predict reactive species
Full Name ras homolog gene family, member A
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC005976
Gene Symbol RHOA
Gene ID (NCBI) 387
RRIDAB_2285104
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP61586
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

What is the function of RhoA?

Ras homolog gene family, member A (RhoA) is a small GTPase that is involved in cytoskeleton organization.1 It is important in actomyosin contractility, as when RhoA binds to GTP it initiates a cascade of events mediating stress fiber or contractile ring formation, where actin bundles crosslink with other proteins. It is also associated with actin polymerization, making RhoA important in membrane ruffling and cell motility.2 The role of RhoA is essential in cell migration and adhesion.

 What is the cellular localization of RhoA?

In motile cells, a leading edge stretches ahead, stabilizes, the cytoskeleton is reorganized, and the tail of the cell retracts. The role of RhoA in contracting actomyosin has linked RhoA with the tail retraction in this process, but studies into the spatiotemporal kinetics of GTPases have revealed that RhoA is also located at the leading edge of migrating cells.3 This highlights the dual roles of this protein in actin contractility and polymerization.

 What is the role of RhoA in disease?

Though it is not an oncogene, the role of RhoA in adhesion and migration has implicated this protein in cancer biology. Expression of RhoA has been found to be higher in malignant tumors compared to benign tumors or in non-tumor tissue, and more invasive tumors have been found to overexpress RhoA.4 This protein is also implicated in neurodegenerative diseases and aging due to its role in axon guidance, with abnormal localization of RhoA associated with Alzheimer's and Parkinson's pathology.5,6 

1.     Ridley, A. J. & Hall, A. The small GTP-binding protein rho regulates the assembly of focal adhesions and actin stress fibers in response to growth factors. Cell 70, 389-399 (1992).

2.     21.   Kurokawa, K. & Matsuda, M. Localized RhoA Activation as a Requirement for the Induction of Membrane Ruffling. Mol. Biol. Cell 16, 4294-4303 (2005).

3.     22.   Struckhoff, A. P., Rana, M. K. & Worthylake, R. A. RhoA can lead the way in tumor cell invasion and metastasis. Front. Biosci. (Landmark Ed. 16, 1915-26 (2011).

4.     23.   Mcglasson, S. et al. Rare variants of the 3'-5' DNA exonuclease in early onset TREX1 small vessel stroke [version 1; referees: awaiting peer review]. doi:10.12688/wellcomeopenres.12631.1

5.     24.   Huesa, G. et al. Altered Distribution of RhoA in Alzheimer's Disease and AβPP Overexpressing Mice. J. Alzheimer's Dis. 19, 37-56 (2010).

6.     25.   Hynds, D. L. Subcellular localization of Rho GTPases: implications for axon regeneration. Neural Regen. Res. 10, 1032-3 (2015).

Protocols

Product Specific Protocols
WB protocol for RHOA antibody 10749-1-APDownload protocol
IF protocol for RHOA antibody 10749-1-APDownload protocol
IP protocol for RHOA antibody 10749-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
HumanWB

Cancer Cell

Targeting the mevalonate pathway suppresses ARID1A-inactivated cancers by promoting pyroptosis

Authors - Wei Zhou
humanIF

Nat Commun

A mosquito salivary protein promotes flavivirus transmission by activation of autophagy.

Authors - Peng Sun
mouseWB

Circ. Res.

Inhibition of KLF5-Myo9b-RhoA Pathway-Mediated Podosome Formation in Macrophages Ameliorates Abdominal Aortic Aneurysm.

Authors - Dong Ma
humanIF

Biomater Res

Near-Infrared Light-Controlled Dynamic Hydrogel for Modulating Mechanosensitive Ion Channels in 3-Dimensional Environment

Authors - Xiaoning Liu
humanWB

Acta Biomater

Adipose-derived stem cells with miR-150-5p inhibition laden in hydroxyapatite/tricalcium phosphate ceramic powders promote osteogenesis via regulating Notch3 and activating FAK/ERK and RhoA

Authors - Fanglin Wang
mouseWB

Autophagy

m6A mRNA methylation regulates testosterone synthesis through modulating autophagy in Leydig cells.

Authors - Yabing Chen
Loading...
||
New chat Able
正在加载,请稍候...