RNF139 Polyclonal antibody

• 

  WB analysis using 28261-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28261-1-AP (RNF139 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat lung using 28261-1-AP

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 28261-1-AP (RNF139 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat lung using 28261-1-AP

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 28261-1-AP (RNF139 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

RNF139 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28261-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

E3 ubiquitin-protein ligase RNF139, EC:2.3.2.27, HRCA1, RCA1, RING finger protein 139

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HT-29 cells, HepG2 cells, THP-1 cells, U-87 MG cells, U2OS cells
• Positive IHC detected in: rat lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28261-1-AP targets RNF139 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27147

  Product name: Recombinant human RNF139 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 511-664 aa of BC064636

  Sequence: QAKNGWKTFMNRRTAVKKINSLPEIKGSRLQEINDVCAICYHEFTTSARITPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQHTGAAAEEFNDDTD

• Full Name: ring finger protein 139
• Calculated Molecular Weight: 664 aa, 76 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC064636
• Gene Symbol: RNF139
• Gene ID (NCBI): 11236
• RRID: AB_3086042
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WU17
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The RNF139 gene (ring-finger protein 139), also known as TRC8 (translocation in renal carcinoma from chromosome 8), was first identified from a family with 3;8 chromosomal translocation and hereditary renal cell carcinoma and thyroid cancer (PMID:22689053). RNF139 encodes an endoplasmic reticulum (ER) protein with 10 transmembrane segments that contain a sterol-sensing domain and a RING finger motif encoding an E3 ubiquitin ligase (PMID: 19706601). Northern blot and dot blot show that RNF139 is highly expressed in the testis, placenta, and adrenal gland and is expressed at lower levels in the heart, brain, liver, skeletal muscle, and pancreas (PMID: 9689122). It is reported that TRC8 suppresses tumorigenesis by targeting heme oxygenase-1 (HO-1), an antioxidant enzyme highly expressed in various cancers, for ubiquitination and degradation (PMID:22689053). TRC8 is also involved in cholesterol and fatty acid biosynthesis that are transcriptionally regulated by the sterol response element binding proteins (SREBPs) (PMID:17016439). Acetylation, phosphorylation, and autoubiquitination are common post-translational modifications of FNF139 protein.