RPL5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RPL5 Polyclonal antibody (29092-1-AP)

RPL5 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 29092-1-AP Copied!

Publications (9)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, monkey

Applications

WB, IHC, IF/ICC, RIP, ELISA

Synonyms

60S ribosomal protein L5, DBA6, Large ribosomal subunit protein uL18, MSTP030, ribosomal protein L5

• 

  WB analysis using 29092-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29092-1-AP (RPL5 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 29092-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29092-1-AP (RPL5 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of U-251 using 29092-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U-251 cells using RPL5 antibody (29092-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RPL5 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: COS-7 cells, MOLT-4 cells, NIH/3T3 cells, C6 cells, PC-3 cells
• Positive IF/ICC detected in: U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29092-1-AP targets RPL5 in WB, IHC, IF/ICC, RIP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.

• Tested Reactivity: human, mouse, rat, monkey
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30837

  Product name: Recombinant human RPL5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 178-297 aa of BC109370

  Sequence: KRFPGYDSESKEFNAEVHRKHIMGQNVADYMRCLMEEDEDAYKKQFSQYIKNSVTPDMMEEMYKKAHAAIRENPVYEKKPKKEVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERAAES

• Full Name: ribosomal protein L5
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC109370
• Gene Symbol: RPL5
• Gene ID (NCBI): 6125
• RRID: AB_2881240
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P46777
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The mammalian ribosome is a macromolecular assembly of 4 RNA species (rRNAs) and approximately 80 different proteins, including RPL5. RPL5 (ribosome protein L15) is rquired for rRNA maturation and formation of the 60S ribosomal subunits, and defects or mutation in RPL5 is the cause of DBA6.

Publications

What published studies show

The anti-RPL5 antibody (Cat# 29092-1-AP) has 9 total citations. These appear in journals including Nature Communications, Science Advances, Cell Death & Differentiation, Oncogene, Cell Reports, iScience, Frontiers in Oncology, and BMC Molecular & Cellular Biology. Research fields span ribosome biogenesis, genome integrity, p53 regulation, pancreatic and colorectal cancer, neurodegeneration, mRNA poly(A) tail control, MAPK/ERK signaling, and endosomal trafficking. Applications are predominantly Western blot, with some RIP and IHC.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; DDX41 resolves G-quadruplexes to maintain erythroid genome integrity and prevent cGAS-mediated cell death; Authors - Honghao Bi
mouse	WB	Sci Adv; VIRMA-mediated m(6)A modification regulates forebrain formation through modulating ribosome biogenesis.; Authors - Min Wu
human	WB,RIP,IHC	Cell Death Differ; hMTR4 promotes p53 protein degradation and tumor growth by accelerating rRNA processing and regulating the RPL5-MDM2 axis; Authors - Chen Xie
human	WB	Oncogene; A cholesterol-dependent LRRC8A-caveolin-1 axis sustains KRAS/EGFR signaling, ribosome biogenesis and growth in pancreatic ductal adenocarcinoma.; Authors - Qing Ye
human	WB	Cell Rep; mTOR- and LARP1-dependent regulation of TOP mRNA poly(A) tail and ribosome loading; Authors - Koichi Ogami
human	WB	iScience; Differential toxicity and localization of arginine-rich C9ORF72 dipeptide repeat proteins depend on de-clustering of positive charges; Authors - Tamami Miyagi