S100A9 Polyclonal antibody

• 

  WB analysis of mouse spleen using 14226-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 14226-1-AP (S100A9 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 14226-1-AP

  WB result of S100A9 antibody (14226-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-S100A9 transfected MCF-7 cells.

• 

  WB analysis of mouse heart using 14226-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 14226-1-AP (S100A9 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat heart using 14226-1-AP

  rat heart tissue were subjected to SDS PAGE followed by western blot with 14226-1-AP (S100A9 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 14226-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 14226-1-AP (S100A9 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human blood using 14226-1-AP

  human blood were subjected to SDS PAGE followed by western blot with 14226-1-AP (S100A9 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 14226-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14226-1-AP (S100A9 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human breast cancer using 14226-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14226-1-AP (S100A9 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human tonsillitis using 14226-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis using 14226-1-AP (S100A9 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human tonsillitis using 14226-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis using 14226-1-AP (S100A9 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human breast cancer using 14226-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 14226-1-AP (S100A9 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human breast cancer using 14226-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 14226-1-AP (S100A9 antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

S100A9 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14226-1-AP

Publications(13)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

60B8AG, CAGB, Calgranulin B, Calprotectin L1H subunit, CFAG, CGLB, L1AG, LIAG, MAC387, MIF, MRP 14, MRP14, NIF, P14, Protein S100 A9, S100A9

---

Tested Applications

• Positive WB detected in: mouse spleen tissue, human blood, human heart tissue, MCF-7 cells, mouse heart tissue, rat heart tissue
• Positive IHC detected in: human breast cancer tissue, human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 4 publications below
• IHC: See 8 publications below
• IF: See 6 publications below

Product Information

14226-1-AP targets S100A9 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5465

  Product name: Recombinant human S100A9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-114 aa of BC047681

  Sequence: MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

• Full Name: S100 calcium binding protein A9
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 14 kDa, 28 kDa
• GenBank Accession Number: BC047681
• Gene Symbol: S100A9
• Gene ID (NCBI): 6280
• RRID: AB_2254232
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P06702
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

S100A9 is a calcium binding protein as a member of the S100 family of proteins. S100 proteins are low molecular weight (9 to 14 kDa) intracellular calcium-binding proteins that control key cellular pathways including regulation of the cytoskeleton, cell migration and adhesion, and host oxidative defense. S100A9 may exist as a homodimer, heterodimer (24 kDa) with an S100A8 partner (S100A8/A9), or as a heterotetramer (28 kDa) with an S100A8 partner(S100A8/A9). S100A8 and S100A9 are found intracellularly in granulocytes, monocytes, and early differentiation stages of macrophages.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Cell Metab; QDPR deficiency drives immune suppression in pancreatic cancer; Authors - Ji Liu
human,mouse	IHC,IF	Int J Cancer; S100 calcium-binding protein A9 from tumor-associated macrophage enhances cancer stem cell-like properties of hepatocellular carcinoma.; Authors - Ran Wei
human,mouse	WB,IHC	Cell Biosci; TRPM8 deficiency attenuates liver fibrosis through S100A9-HNF4α signaling.; Authors - Qiang Liu ; KD Validated
rat	IF	Int J Med Sci; Single-cell RNA Sequencing Uncovered the Involvement of an Endothelial Subset in Neutrophil Recruitment in Chemically Induced Rat Pulmonary Inflammation.; Authors - Hong Huang
human	WB,IF	J Oncol; Downregulation of S100A9 Reverses Cisplatin-Resistance and Inhibits Proliferation and Migration in Hypopharyngeal Carcinoma; Authors - Shiyu Zeng ; KD Validated
human	IHC	Histol Histopathol; Histopathological assessment of calcification and inflammation of calcific aortic valves from patients with and without diabetes mellitus.; Authors - Josephin Mosch