SR-BI Polyclonal antibody

• 

  WB analysis of human brain using 21277-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 21277-1-AP (SR-BI antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 21277-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21277-1-AP (SR-BI antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 21277-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 21277-1-AP (SR-BI antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 21277-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 21277-1-AP (SR-BI antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 21277-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 21277-1-AP (SR-BI antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

SR-BI Polyclonal Antibody for WB, ELISA

Cat No. 21277-1-AP

Publications(21)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

SCARB1, CD36, CD36 antigen-like 1, CLA 1, CLA1

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, HepG2 cells, human brain tissue, human testis tissue, mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 19 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

21277-1-AP targets SR-BI in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15759

  Product name: Recombinant human SCARB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-230 aa of BC022087

  Sequence: MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISR

• Full Name: scavenger receptor class B, member 1
• Calculated Molecular Weight: 552 aa, 61 kDa
• Observed Molecular Weight: 61-82 kDa
• GenBank Accession Number: BC022087
• Gene Symbol: SR-BI
• Gene ID (NCBI): 949
• RRID: AB_10858921
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WTV0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Biomaterials; Targeted immunomodulation of inflammatory monocytes across the blood-brain barrier by curcumin-loaded nanoparticles delays the progression of experimental autoimmune encephalomyelitis.; Authors - Lisen Lu
	WB	J Virol; Dengue virus NS1 leads to downregulation of HNF4 alpha in liver cells resulting in a decrease in coagulation factors I, V, X, and XIII, contributing to coagulopathy; Authors - Sandeepan Das
mouse	WB,IHC	Atherosclerosis; Flagellar hook protein FlgE promotes macrophage activation and atherosclerosis by targeting ATP5B; Authors - Yuanyuan Li
		J Virol; Neglected but Important Role of Apolipoprotein E Exchange in Hepatitis C Virus Infection.; Authors - Zaili Yang
mouse	WB	J Cell Mol Med; Photobiomodulation therapy promotes the ATP-binding cassette transporter A1-dependent cholesterol efflux in macrophage to ameliorate atherosclerosis.; Authors - Qianxia Yin
mouse		J Sci Food Agric; L-Theanine regulates lipid metabolism by modulating gut microbiota and bile acid metabolism; Authors - Wei Xu