Secretogranin III Polyclonal antibody

• 

  IHC staining of mouse pancreas using 10954-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 10954-1-AP (Secretogranin III antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse pancreas using 10954-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 10954-1-AP (Secretogranin III antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 10954-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 10954-1-AP (Secretogranin III antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 10954-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 10954-1-AP (Secretogranin III antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse pancreas using 10954-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse pancreas tissue using Secretogranin III antibody (10954-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse pancreas using 10954-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse pancreas tissue using Secretogranin III antibody (10954-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

Secretogranin III Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 10954-1-AP

Publications(13)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF-P, ELISA

Synonyms

SCG3, UNQ2502/PRO5990, SgIII, Secretogranin-3, Secretogranin 3

---

Tested Applications

• Positive IHC detected in: mouse pancreas tissue, human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse pancreas tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 5 publications below
• IHC: See 5 publications below
• IF: See 6 publications below

Product Information

10954-1-AP targets Secretogranin III in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1397

  Product name: Recombinant human SCG3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-468 aa of BC014539

  Sequence: MGFLGTGTWILVLVLPIQAFPKPGGSQDKSLHNRELSAERPLNEQIAEAEEDKIKKTYPPENKPGQSNYSFVDNLNLLKAITEKEKIEKERQSIRSSPLDNKLNVEDVDSTKNRKLIDDYDSTKSGLDHKFQDDPDGLHQLDGTPLTAEDIVHKIAARIYEENDRAAFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNFYALLKSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDNISKLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLKKHDKKGNKEDYDLSKMRDFINKQADAYVEKGILDKEEAEAIKRIYSSL

• Full Name: secretogranin III
• Calculated Molecular Weight: 53 kDa
• GenBank Accession Number: BC014539
• Gene Symbol: Secretogranin 3
• Gene ID (NCBI): 29106
• RRID: AB_2190449
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WXD2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Secretogranin III (SCG3), a member of the granin protein family, is expressed specifically in neuronal and endocrine cells. SCG3 was synthesized as a 61- or 63-kDa protein and processed to a 48-kDa form which, in turn, was partially cleaved to fragments of 28 and 20 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Exp Med; Secretogranin III as a disease-associated ligand for antiangiogenic therapy of diabetic retinopathy.; Authors - Michelle E LeBlanc
human	WB,IHC	Cancer Lett; The oncoprotein HBXIP up-regulates SCG3 through modulating E2F1 and miR-509-3p in hepatoma cells.; Authors - Yue Wang ; KD Validated
mouse	WB,IHC	Cereb Cortex; Secretogranin III is an astrocyte granin that is overexpressed in reactive glia.; Authors - Paco Sonia S
human, mouse	IHC	Brain Pathol; Secretory sorting receptors carboxypeptidase E and secretogranin III in amyloid β-associated neural degeneration in Alzheimer's disease.; Authors - Virginia Plá
Mouse	WB	Epigenetics Chromatin; Developmental nicotine exposure engenders intergenerational downregulation and aberrant posttranslational modification of cardinal epigenetic factors in the frontal cortices, striata, and hippocampi of adolescent mice.; Authors - Jordan M Buck
mouse	IHC,IF	J Endocrinol; Secretogranin II binds to secretogranin III and forms secretory granules with orexin, neuropeptide Y, and POMC.; Authors - Hotta Kikuko K