CoraLite® Plus 488-conjugated Secretogranin III Polyclonal antibody

• 

  IF Staining of mouse pancreas using CL488-10954

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse pancreas tissue using CoraLite® Plus 488 Secretogranin III antibody (CL488-10954) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse pancreas using CL488-10954

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse pancreas tissue using CoraLite® Plus 488 Secretogranin III antibody (CL488-10954) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

Secretogranin III Polyclonal Antibody for IF-P

Cat No. CL488-10954

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF-P

Synonyms

FLJ90833, SCG3, Secretogranin 3, secretogranin III, SGIII

---

Tested Applications

• Positive IF-P detected in: mouse pancreas tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10954 targets Secretogranin III in IF-P applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1397

  Product name: Recombinant human SCG3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-468 aa of BC014539

  Sequence: MGFLGTGTWILVLVLPIQAFPKPGGSQDKSLHNRELSAERPLNEQIAEAEEDKIKKTYPPENKPGQSNYSFVDNLNLLKAITEKEKIEKERQSIRSSPLDNKLNVEDVDSTKNRKLIDDYDSTKSGLDHKFQDDPDGLHQLDGTPLTAEDIVHKIAARIYEENDRAAFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNFYALLKSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDNISKLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLKKHDKKGNKEDYDLSKMRDFINKQADAYVEKGILDKEEAEAIKRIYSSL

• Full Name: secretogranin III
• Calculated Molecular Weight: 53 kDa
• GenBank Accession Number: BC014539
• Gene Symbol: Secretogranin 3
• Gene ID (NCBI): 29106
• RRID: AB_3672474
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WXD2
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Secretogranin III (SCG3), a member of the granin protein family, is expressed specifically in neuronal and endocrine cells. SCG3 was synthesized as a 61- or 63-kDa protein and processed to a 48-kDa form which, in turn, was partially cleaved to fragments of 28 and 20 kDa.