Recombinant human SCN2B protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag4515
Synonyms
SCN2B, Sodium channel subunit beta 2, Sodium channel subunit beta-2, UNQ326/PRO386
Validation Data Gallery View All
Product Information
| Peptide Sequence |
SMEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVI
(29-161 aa encoded by BC036793) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
