SEC14L3 Polyclonal antibody

• 

  WB analysis using 32098-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32098-1-AP (SEC14L3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 32098-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SEC14L3 antibody (32098-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

SEC14L3 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 32098-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Tocopherol-associated protein 2, TAP2, SEC14-like protein 3

---

Tested Applications

• Positive WB detected in: mouse liver tissue, mouse lung tissue, rat lung tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32098-1-AP targets SEC14L3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36792

  Product name: Recombinant human SEC14L3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 110-182 aa of BC069641

  Sequence: GLLFSVTKQDLLKTKMRDCERILHECDLQTERLGKKIETIVMIFDCEGLGLKHFWKPLVEVYQEFFGLLEENY

• Full Name: SEC14-like 3 (S. cerevisiae)
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC069641
• Gene Symbol: SEC14L3
• Gene ID (NCBI): 266629
• RRID: AB_3670189
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9UDX4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SEC14L3 is highly similar to the protein encoded by the Saccharomyces cerevisiae SEC14 gene. The SEC14 protein is a phophatidylinositol transfer protein that is essential for biogenesis of Golgi-derived transport vesicles, and thus is required for the export of yeast secretory proteins from the Golgi complex. The specific function of this protein has not yet been determined. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.