SEC31A Polyclonal antibody

• 

  WB analysis using 17913-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17913-1-AP (SEC31A antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 17913-1-AP

  IP result of anti-SEC31A (IP:17913-1-AP, 4ug; Detection:17913-1-AP 1:5000) with HeLa cells lysate 1320 ug.

• 

  IHC staining of mouse brain using 17913-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17913-1-AP (SEC31A antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 17913-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17913-1-AP (SEC31A antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 17913-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 17913-1-AP (SEC31A antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 17913-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using SEC31A antibody (17913-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

• 

  IF Staining of HeLa using 17913-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using SEC31A antibody (17913-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

• 

  IF Staining of HeLa using 17913-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 17913-1-AP (SEC31A antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

SEC31A Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 17913-1-AP

Publications(13)

Reviews (3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

ABP125, ABP130, KIAA0905, SEC31 like protein 1, SEC31 related protein A

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: mouse brain tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 8 publications below
• IF: See 6 publications below
• IP: See 1 publications below

Product Information

17913-1-AP targets SEC31A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12314

  Product name: Recombinant human SEC31A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 758-1106 aa of BC084583

  Sequence: AAQGSIAAALAFLPDNTNQPNIMQLRDRLCRAQGEPVAGHESPKIPYEKQQLPKGRPGPVAGHHQMPRVQTQQYYPHGENPPPPGFIMHGNVNPNAAGQLPTSPGHMHTQVPPYPQPQRPQNGWNDPPALNRVPKKKKMPENFMPPVPITSPIMNPLGDPQSQMLQQQPSAPVPLSSQSSFPQPHLPGGQPFHGVQQPLGQTGMPPSFSKPNIEGAPGAPIGNTFQHVQSLPTKKITKKPIPDEHLILKTTFEDLIQRCLSSATDPQTKRKLDDASKRLEFLYDKLREQTLSPTITSGLHNIARSIETRNYSEGLTMHTHIVSTSNFSETSAFMPVLKVVLTQANKLGV

• Full Name: SEC31 homolog A (S. cerevisiae)
• Calculated Molecular Weight: 1220 aa, 133 kDa
• Observed Molecular Weight: 118-140 kDa
• GenBank Accession Number: BC084583
• Gene Symbol: SEC31A
• Gene ID (NCBI): 22872
• RRID: AB_2186378
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94979
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COPII-coated vesicles mediate anterograde transport from the ER to the Golgi apparatus. COPII is composed of three parts: two coat protein complexes (Sec23/24 complex and Sec13/31 complex) and one small GTP-binding protein, Sar1 (PMID: 9568718). The sec31 subunit of the coat complex has been shown to be essential for vesicle formation and ER-Golgi transport (PMID: 10788476). Two mammalian homologues of yeast sec31p, Sec31A and Sec31B, share about 40% amino acid identity. Sec31A transcripts are ubiquitously and abundantly expressed.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	Nature; CRISPR screens unveil signal hubs for nutrient licensing of T cell immunity.; Authors - Lingyun Long ; KO Validated
mouse	IF	Cell; Small Molecule Targets TMED9 and Promotes Lysosomal Degradation to Reverse Proteinopathy.; Authors - Moran Dvela-Levitt
mouse	IF	Nat Cell Biol; Manganese regulation of COPII condensation controls circulating lipid homeostasis; Authors - Xiao Wang
human	IF	Dev Cell; SURF4-induced tubular ERGIC selectively expedites ER-to-Golgi transport.; Authors - Rui Yan
mouse,human	WB	Redox Biol; Selenoprotein K contributes to CD36 subcellular trafficking in hepatocytes by accelerating nascent COPII vesicle formation and aggravates hepatic steatosis; Authors - Mengyue You
human	WB	Anal Chem; Ionic Liquid-Based Extraction System for In-Depth Analysis of Membrane Protein Complexes.; Authors - Hongwei Chu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Boyan (Verified Customer) (09-01-2020)

This antibody labels a strong band around the expected molecular weight.

• Applications: Western Blot

FH

RICHA (Verified Customer) (09-29-2019)

Clean, excellent and specific

• Applications: Western Blot,
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Protein from mouse tail tendon

SEC31A Antibody Western Blot, validation (1:500 dilution) in Protein from mouse tail tendon (Cat no:17913-1-AP)

FH

Rui (Verified Customer) (09-28-2019)

Labels intracellular vesicles with clear contrast. Cell monolayer fixed by 0.3% glutaraldehyde and 3% paraformaldehyde. Permeabilization: 0.1% saponin and 3% BSA in PBS. Primary antibody overnight at 4C.

• Applications: Immunofluorescence,
• Primary Antibody Dilution: 1:300
• Cell Tissue Type: Cos-7

SEC31A Antibody Immunofluorescence, validation (1:300 dilution) in Cos-7 (Cat no:17913-1-AP)