Tested Applications
| Positive WB detected in | HeLa cells, human kidney tissue, human placenta tissue, human urine sample, mouse liver tissue, mouse lung tissue, mouse skin tissue, HepG2 cells, mouse kidney tissue, human saliva |
| Positive IP detected in | mouse kidney tissue |
| Positive IHC detected in | mouse liver tissue, human colon tissue, human liver cancer tissue, mouse kidney tissue, rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse liver tissue |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16382-1-AP targets Alpha-1-Antitrypsin in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9369 Product name: Recombinant human Alpha-1-Antitrypsin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 28-418 aa of BC015642 Sequence: QGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQATTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK Predict reactive species |
| Full Name | serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 |
| Calculated Molecular Weight | 418 aa, 47 kDa |
| Observed Molecular Weight | 47-51 kDa |
| GenBank Accession Number | BC015642 |
| Gene Symbol | Alpha 1-Antitrypsin |
| Gene ID (NCBI) | 5265 |
| RRID | AB_10641185 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01009 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SERPINA1 is the gene for a protein called alpha-1-antitrypsin (AAT), which is a serine protease inhibitor whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. AAT is a glycoprotein synthesized primarily by hepatocytes, with smaller amountssynthesized by intestinal epithelial cells, neutrophils, pulmonary alveolar cells and macrophages. AAT is the most abundant, endogenous serine protease inhibitor in blood circulation and it has been implicated in regulating vital fluid phase biological events such as blood coagulation, fibrinolysis, complement activation, apoptosis, reproduction, tumor progression and inflammatory response. The primary function of AAT is thought to be the inactivation of neutrophil elastase and other endogenous serine proteases. Defects in SERPINA1 can cause emphysema or liver disease. Alpha 1 Antitrypsin has two bands (PMID: 36703990, PMID: 26869867).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Alpha-1-Antitrypsin antibody 16382-1-AP | Download protocol |
| IF protocol for Alpha-1-Antitrypsin antibody 16382-1-AP | Download protocol |
| IHC protocol for Alpha-1-Antitrypsin antibody 16382-1-AP | Download protocol |
| IP protocol for Alpha-1-Antitrypsin antibody 16382-1-AP | Download protocol |
| WB protocol for Alpha-1-Antitrypsin antibody 16382-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
16382-1-AP is an anti-SERPINA1 (Alpha-1 Antitrypsin) antibody with 40 total citations. It appears in high-impact journals including Nature, Cell, Nature Communications, Cell Reports, FEBS Journal, and Journal of Biological Chemistry, among 30+ others. Research fields span cancer biology, inflammation, liver metabolism, proteomics, gene therapy, ER stress/ERAD, immunology, and infectious disease. Applications are predominantly Western blot, with additional use in IF, IHC, and IP.
| Species | Application | Title |
|---|---|---|
Cell snoRNA-facilitated protein secretion revealed by transcriptome-wide snoRNA target identification | ||
Nat Commun Alpha-1 antitrypsin inhibits TMPRSS2 protease activity and SARS-CoV-2 infection. | ||
Reviews
What customers say
The single review for this AAT antibody reports successful use in Western blot on Hep40 cells at a 1:50000 dilution. The user observed a single, well-defined band, indicating strong specificity and clean signal. The product received a 5-star rating, reflecting high satisfaction with performance and reliability in this application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Claudia (Verified Customer) (02-05-2026) | Western blot in Hep40 cells using the AAT antibody It works well, a single well defined band is observed. *The first line is the kaleidoscope biorad protein ladder
 |
