Tested Applications
Positive WB detected in | mouse kidney tissue, rat kidney tissue |
Positive IHC detected in | human kidney tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse kidney tissue, rat kidney tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
Product Information
28683-1-AP targets SGLT2 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, mouse, rat samples.
Tested Reactivity | Human, mouse, rat |
Cited Reactivity | mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30120 Product name: Recombinant human SLC5A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 222-285 aa of BC131542 Sequence: EVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTI Predict reactive species |
Full Name | solute carrier family 5 (sodium/glucose cotransporter), member 2 |
Calculated Molecular Weight | 672 aa, 73 kDa |
Observed Molecular Weight | 73 kDa |
GenBank Accession Number | BC131542 |
Gene Symbol | SGLT2 |
Gene ID (NCBI) | 6524 |
RRID | AB_2918190 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P31639 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Sodium-glucose cotransporter 2 (SGLT2), encoded by SLC5A2, utilizes the electrochemical sodium gradient to transport glucose against the cell's internal concentration gradient. Mainly expressed on brush border membrane (BBM) of epithelial cells in the early segment of the proximal tubule, SGLT2 mediates most of the glucose reabsorption by the kidney overall. Inhibition of SGLT2 could improve glucose homeostasis of diabetic patients, which has been considered as a novel strategy for diabetes treatment.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SGLT2 antibody 28683-1-AP | Download protocol |
IHC protocol for SGLT2 antibody 28683-1-AP | Download protocol |
IF protocol for SGLT2 antibody 28683-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Basic Res Cardiol Empagliflozin prevents heart failure through inhibition of the NHE1-NO pathway, independent of SGLT2 | ||
Br J Pharmacol The eukaryotic elongation factor 2 kinase inhibitor, A484954, induces hypoglycaemic and hypotensive effects |