Recombinant human SIRPG protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag2430
Synonyms
SIRP gamma, SIRPG, CD172 antigen-like family member B, CD172 gamma, CD172g
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MPVPASWPHPPGPFLLLTLLLGLTEVAGEEELQMIQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGGPASSLTALLLIAVLLGPIYVPWKQKT
(1-170 aa encoded by BC020629) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
