• Featured Product
  • KD/KO Validated

DMT1 Polyclonal antibody

DMT1 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA
Cat No. 20507-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, IF-P, ELISA

SLC11A2, Solute carrier family 11 member 2, OK/SW-cl.20, Natural resistance-associated macrophage protein 2, DMT-1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHuH-7 cells, COLO 320 cells, Caco-2 cells, rat kidney tissue, SH-SY5Y cells, Neuro-2a cells
Positive IHC detected inmouse brain tissue, human pancreas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse small intestine tissue, mouse brain tissue
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:400-1:1600
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20507-1-AP targets DMT1 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, chicken, bovine, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14314

Product name: Recombinant human SLC11A2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-80 aa of BC002592

Sequence: MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCFSFRKLWAFTGPGFLM

Predict reactive species
Full Name solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2
Calculated Molecular Weight 568 aa, 62 kDa
Observed Molecular Weight 60-70 kDa
GenBank Accession NumberBC002592
Gene Symbol DMT1
Gene ID (NCBI) 4891
RRIDAB_10694284
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP49281
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC11A2 (also known as DMT1, Nramp2, and DCT1) is a member of the divalent cation transporters that play a central role in iron homeostasis. SLC11A2 is widely expressed in many tissues including the brain, kidney, testis, duodenum, and placenta. As a membrane protein, SLC11A2 is localized on the apical membrane of enterocytes as well as in transferrin-cycle endosomes. Four isoforms of SLC11A2 exist due to the alternative splicing. They differ at the NH2 and COOH termini but share a common central domain. A variety of molecular weights of SLC11A2 in western blot analysis, ranging from 50 to 100 kDa, has been reported in different cells and species. The differences in molecular weights may be attributed to the level of glycosylation, proteolysis, or the membrane protein itself. This antibody detected various forms of SLC11A2 of 45-100 kDa.

Protocols

Product Specific Protocols
WB protocol for DMT1 antibody 20507-1-APDownload protocol
IHC protocol for DMT1 antibody 20507-1-APDownload protocol
IF protocol for DMT1 antibody 20507-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Blood

Defective palmitoylation of transferrin receptor triggers iron overload in Friedreich ataxia fibroblasts.

Authors - Floriane Petit
humanIHC

Acta Neuropathol

Seizure-mediated iron accumulation and dysregulated iron metabolism after status epilepticus and in temporal lobe epilepsy.

Authors - Till S Zimmer
mouseWB

Mol Cell

Maintaining Iron Homeostasis Is the Key Role of Lysosomal Acidity for Cell Proliferation.

Authors - Ross A Weber
humanWB

Sci Adv

Magnetically attracting hydrogel reshapes iron metabolism for tissue repair

Authors - Yichang Xu
mouseWB

J Hazard Mater

Investigating the potential risk of cadmium exposure on seizure severity and anxiety-like behaviors through the ferroptosis pathway in epileptic mice: An integrated multi-omics approach

Authors - Yuanjin Chang
mouseIF

Nat Commun

Wipi3 is essential for alternative autophagy and its loss causes neurodegeneration.

Authors - Hirofumi Yamaguchi
Loading...
||
New chat Able
正在加载,请稍候...