• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated DMT1 Polyclonal antibody

DMT1 Polyclonal Antibody for IF-P
Cat No. CL488-20507

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

DCT1, Divalent cation transporter 1, Divalent metal transporter 1, DMT 1, DMT1, FLJ37416, NRAMP 2, NRAMP2, SLC11A2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse small intestine tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-20507 targets DMT1 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14314

Product name: Recombinant human SLC11A2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-80 aa of BC002592

Sequence: MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCFSFRKLWAFTGPGFLM

Predict reactive species
Full Name solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2
Calculated Molecular Weight 568 aa, 62 kDa
Observed Molecular Weight 60-70 kDa
GenBank Accession NumberBC002592
Gene Symbol DMT1
Gene ID (NCBI) 4891
RRIDAB_3084034
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP49281
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SLC11A2 (also known as DMT1, Nramp2, and DCT1) is a member of the divalent cation transporters that plays a central role in iron homeostasis. SLC11A2 is widely expressed in many tissues including brain, kidney, testis, duodenum and placenta. As a membrane protein, SLC11A2 is localized on the apical membrane of enterocytes as well as in transferrin-cycle endosomes. Four isoforms of SLC11A2 exist due to the alternative splicing. They differ at the NH2 and COOH termini but share a common central domain. A variety of molecular weights of SLC11A2 in western blot analysis, ranging from 50 to 100 kDa, has been reported in different cells and species. The differences in molecular weights may be attributed to the level of glycosylation, proteolysis, or the membrane protein itself. This antibody detected various forms of SLC11A2 of 45-100 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 DMT1 antibody CL488-20507Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...