SLC13A4 Polyclonal antibody

SLC13A4 Polyclonal Antibody for WB, IF/ICC, ELISA
Cat No. 20302-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

SUT1, SUT 1, NaS2, Na(+)/sulfate cotransporter SUT-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells
Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20302-1-AP targets SLC13A4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14116

Product name: Recombinant human SLC13A4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 123-285 aa of BC030689

Sequence: LLLCFMCCTTLLSMWLSNTSTTAMVMPIVEAVLQELVSAEDEQLVAGNSNTEEAEPISLDVKNSQPSLELIFVNEESNADLTTLMHNENLNGVPSITNPIKTANQHQGKKQHPSQEKPQVLTRSPRKQKLNRKYRSHHDQMICKCLSLSISYSATIGGLTTII

Predict reactive species
Full Name solute carrier family 13 (sodium/sulfate symporters), member 4
Calculated Molecular Weight 626 aa, 69 kDa
Observed Molecular Weight 69 kDa
GenBank Accession NumberBC030689
Gene Symbol SLC13A4
Gene ID (NCBI) 26266
RRIDAB_10793722
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UKG4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC13A4 (also known as SUT-1 or NaS2) belongs to the family of Na+-coupled anion transporters and mediates sulfate reabsorption in the high endothelial venules (HEV). Sulfate is an obligate nutrient for fetal development. Highly expressed in placenta, SLC13A4 has been proposed to play important physiological roles in maintaining high maternal serum sulfate levels during pregnancy and mediating sulfate supply to the fetus.

Protocols

Product Specific Protocols
IF protocol for SLC13A4 antibody 20302-1-APDownload protocol
WB protocol for SLC13A4 antibody 20302-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB,IHC

Biol Reprod

Placental, renal, and ileal sulfate transporter gene expression in mouse gestation.

Authors - Dawson Paul A PA
mouseIHC

EBioMedicine

Postnatal N-acetylcysteine administration rescues impaired social behaviors and neurogenesis in Slc13a4 haploinsufficient mice.

Authors - Zhe Zhang
Loading...
||
New chat Able
正在加载,请稍候...