SMG6 Monoclonal antibody, PBS Only

• 

  WB analysis using 68109-1-Ig (same clone as 68109-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68109-1-Ig (SMG6 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with Lamin B1 Monoclonal antibody (66095-1-Ig) as loading control. This data was developed using the same antibody clone with 68109-1-PBS in a different storage buffer formulation.

• 

  WB analysis of RAW 264.7 using 68109-1-Ig (same clone as 68109-1-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 68109-1-Ig (SMG6 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68109-1-PBS in a different storage buffer formulation.

SMG6 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68109-1-PBS

Clone No.1D2G2

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse

Applications

WB, Indirect ELISA

Synonyms

C17orf31, EST1 like protein A, EST1A, Ever shorter telomeres 1A, hSmg5/7a, KIAA0732, SMG 6, Smg 6 homolog, SMG6, Telomerase subunit EST1A

---

Product Information

68109-1-PBS targets SMG6 in WB, Indirect ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30182

  Product name: Recombinant human SMG6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1282-1419 aa of NM_017575

  Sequence: ELDGLAKGQETDHRAGGYARVVQEKARKSIEFLEQRFESRDSCLRALTSRGNELESIAFRSEDITGQLGNNDDLILSCCLHYCKDKAKDFMPASKEEPIRLLREVVLLTDDRNLRVKALTRNVPVRDIPAFLTWAQVG

• Full Name: Smg-6 homolog, nonsense mediated mRNA decay factor (C. elegans)
• Calculated Molecular Weight: 160 kDa
• Observed Molecular Weight: 160 kDa
• GenBank Accession Number: NM_017575
• Gene Symbol: SMG6
• Gene ID (NCBI): 23293
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q86US8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SMG6, also known as C17orf31, EST1A, and hEST1A, is a component of the telomerase ribonucleoprotein (RNP) complex that is essential for the replication of chromosome termini (PMID: 19179534). It promotes in vitro the ability of TERT to elongate telomeres (PMID: 12676087, 12699629). SMG6 also plays a role in the nonsense-mediated mRNA decay (NMD) pathway, providing the endonuclease activity near the premature translation termination codon that is needed to initiate NMD (PMID: 19060897, 20930030). Alternate splicing results in multiple transcript variants (PMID: 12699629, 14636577).