SMURF1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68466-1-Ig (same clone as 68466-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68466-1-Ig (SMURF1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 68466-1-PBS in a different storage buffer formulation.

SMURF1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68466-1-PBS

Clone No.2A7E4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

2A7E4, E3 ubiquitin-protein ligase SMURF1, EC:2.3.2.26, HECT-type E3 ubiquitin transferase SMURF1, hSMURF1

---

Product Information

68466-1-PBS targets SMURF1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30891

  Product name: Recombinant human SMURF1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 150-269 aa of NM_020429

  Sequence: VDCRGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPS

• Full Name: SMAD specific E3 ubiquitin protein ligase 1
• Calculated Molecular Weight: 86 kDa
• Observed Molecular Weight: 86 kDa
• GenBank Accession Number: NM_020429
• Gene Symbol: SMURF1
• Gene ID (NCBI): 57154
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9HCE7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SMURF1, also named as KIAA1625, is E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. SMURF1 interacts with receptor-regulated SMADs specific for the BMP pathway, SMAD1 and SMAD5, in order to trigger their ubiquitination and degradation and hence their inactivation. SMURF1 can be detected as 90-100 kDa when ubiquitinated (PMID:17576816, PMID:20484049).