Product Information
68466-1-PBS targets SMURF1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30891 Product name: Recombinant human SMURF1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 150-269 aa of NM_020429 Sequence: VDCRGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPS Predict reactive species |
| Full Name | SMAD specific E3 ubiquitin protein ligase 1 |
| Calculated Molecular Weight | 86 kDa |
| Observed Molecular Weight | 86 kDa |
| GenBank Accession Number | NM_020429 |
| Gene Symbol | SMURF1 |
| Gene ID (NCBI) | 57154 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9HCE7 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SMURF1, also named as KIAA1625, is E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. SMURF1 interacts with receptor-regulated SMADs specific for the BMP pathway, SMAD1 and SMAD5, in order to trigger their ubiquitination and degradation and hence their inactivation. SMURF1 can be detected as 90-100 kDa when ubiquitinated (PMID:17576816, PMID:20484049).

