SNRPB Polyclonal antibody

• 

  WB analysis using 16807-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16807-1-AP (SNRPB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 16807-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16807-1-AP (SNRPB antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human cervical cancer using 16807-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 16807-1-AP (SNRPB antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 16807-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 16807-1-AP (SNRPB antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 16807-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16807-1-AP (SNRPB antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 16807-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16807-1-AP (SNRPB antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 16807-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16807-1-AP (SNRPB Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver cancer using 16807-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16807-1-AP (SNRPB Antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

SNRPB Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16807-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IP, ELISA

Synonyms

Sm protein B/B, Sm protein B/B', Small nuclear ribonucleoprotein associated proteins B and B', Small nuclear ribonucleoprotein-associated proteins B and B', SmB/B

---

Tested Applications

• Positive WB detected in: Jurkat cells, K-562 cells
• Positive IHC detected in: human cervical cancer tissue, human liver cancer tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 3 publications below
• IHC: See 4 publications below
• IP: See 2 publications below

Product Information

16807-1-AP targets SNRPB in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10298

  Product name: Recombinant human SNRPB protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-234 aa of BC003530

  Sequence: MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGKCLQW

• Full Name: small nuclear ribonucleoprotein polypeptides B and B1
• Calculated Molecular Weight: 234aa,25 kDa; 285aa,30 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC003530
• Gene Symbol: SNRPB
• Gene ID (NCBI): 6628
• RRID: AB_2878319
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P14678
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SNRPB (Small Nuclear Ribonucleoprotein Polypeptides B and B1) is a core component of the spliceosome, a complex molecular machine that plays a critical role in pre-mRNA splicing. This process is essential for the removal of introns and the joining of exons to produce mature mRNA molecules.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	Elife; Type I and II PRMTs inversely regulate post-transcriptional intron detention through Sm and CHTOP methylation.; Authors - Maxim I Maron
human	IHC	Cell Death Dis; SNRPB promotes the tumorigenic potential of NSCLC in part by regulating RAB26.; Authors - Nianli Liu ; KO Validated
human	IHC	Ann Med; SNRPB and CEP290, predicting the prognosis of diffuse large B cell lymphoma and associated with tumour immune microenvironment; Authors - Jing Tang
mouse	IP	Adv Sci (Weinh); PRMT5 Maintains Homeostasis of the Intestinal Epithelium by Modulating Cell Proliferation and Survival; Authors - Leilei Li
mouse,human	WB,IHC	Aging (Albany NY); SNRPB promotes the progression of hepatocellular carcinoma via regulating cell cycle, oxidative stress, and ferroptosis; Authors - Xiaoyan Wang
human	WB,IHC	Oncogene; The splicing factor SNRPB promotes ovarian cancer progression through regulating aberrant exon skipping of POLA1 and BRCA2; Authors - Yingwei Li ; KD Validated