• Featured Product
  • KD/KO Validated

SNRPB Polyclonal antibody

SNRPB Polyclonal Antibody for WB, IHC, ELISA
Cat No. 16807-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IP, ELISA

Sm protein B/B, Sm protein B/B', Small nuclear ribonucleoprotein associated proteins B and B', Small nuclear ribonucleoprotein-associated proteins B and B', SmB/B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, K-562 cells
Positive IHC detected inhuman cervical cancer tissue, human liver cancer tissue, human lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16807-1-AP targets SNRPB in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10298

Product name: Recombinant human SNRPB protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 1-234 aa of BC003530

Sequence: MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGKCLQW

Predict reactive species
Full Name small nuclear ribonucleoprotein polypeptides B and B1
Calculated Molecular Weight234aa,25 kDa; 285aa,30 kDa
Observed Molecular Weight 25-30 kDa
GenBank Accession NumberBC003530
Gene Symbol SNRPB
Gene ID (NCBI) 6628
RRIDAB_2878319
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP14678
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SNRPB (Small Nuclear Ribonucleoprotein Polypeptides B and B1) is a core component of the spliceosome, a complex molecular machine that plays a critical role in pre-mRNA splicing. This process is essential for the removal of introns and the joining of exons to produce mature mRNA molecules.

Protocols

Product Specific Protocols
IHC protocol for SNRPB antibody 16807-1-APDownload protocol
WB protocol for SNRPB antibody 16807-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IP

Elife

Type I and II PRMTs inversely regulate post-transcriptional intron detention through Sm and CHTOP methylation.

Authors - Maxim I Maron
humanIHC

Cell Death Dis

SNRPB promotes the tumorigenic potential of NSCLC in part by regulating RAB26.

Authors - Nianli Liu
  • KO Validated
humanIHC

Ann Med

SNRPB and CEP290, predicting the prognosis of diffuse large B cell lymphoma and associated with tumour immune microenvironment

Authors - Jing Tang
mouseIP

Adv Sci (Weinh)

PRMT5 Maintains Homeostasis of the Intestinal Epithelium by Modulating Cell Proliferation and Survival

Authors - Leilei Li
mouse,humanWB,IHC

Aging (Albany NY)

SNRPB promotes the progression of hepatocellular carcinoma via regulating cell cycle, oxidative stress, and ferroptosis

Authors - Xiaoyan Wang
humanWB,IHC

Oncogene

The splicing factor SNRPB promotes ovarian cancer progression through regulating aberrant exon skipping of POLA1 and BRCA2

Authors - Yingwei Li
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...