SNX5 Monoclonal antibody, PBS Only

• 

  WB analysis using 67665-1-Ig (same clone as 67665-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67665-1-Ig (SNX5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67665-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67665-1-Ig (same clone as 67665-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67665-1-Ig (SNX5 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67665-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67665-1-Ig (same clone as 67665-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67665-1-Ig (SNX5 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67665-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67665-1-Ig (same clone as 67665-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 67665-1-Ig (SNX5 antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). F-actin was stained using CoraLite®594-phalloidin (red) and DNA was stained by DAPI (blue). This data was developed using the same antibody clone with 67665-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Caco-2 using 67665-1-Ig (same clone as 67665-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed Caco-2 cells using SNX5 antibody (67665-1-Ig, Clone: 2F8A4 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 67665-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 67665-1-Ig (same clone as 67665-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human SNX5 (67665-1-Ig, Clone:2F8A4) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2a Isotype Control (66360-2-Ig, Clone: K11A1B2A2) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 67665-1-PBS in a different storage buffer formulation.

SNX5 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 67665-1-PBS

Clone No.2F8A4

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

2F8A4, Sorting nexin-5

---

Product Information

67665-1-PBS targets SNX5 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12330

  Product name: Recombinant human SNX5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-404 aa of BC093623

  Sequence: MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN

• Full Name: sorting nexin 5
• Calculated Molecular Weight: 404 aa, 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC093623
• Gene Symbol: SNX5
• Gene ID (NCBI): 27131
• RRID: AB_2882861
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y5X3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Sorting nexins are a diverse group of cytoplasmic and membrane-associated proteins that are classified by the presence of a phospholipid-binding motif-the PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. SNX5 (Sorting nexin-5) was originally identified as a putative FANCA-binding protein (PMID: 10600472). SNX5 has a phox homology (PX) domain in the N-terminus. It is involved in several stages of intracellular trafficking. SNX5 is a component of the mammalian retromer complex, which is involved in recycling proteins from endosomes to the trans-Golgi network or plasma membrane (PMID: 17148574; 26199408).