SORLA Monoclonal antibody, PBS Only

• 

  WB analysis using 68651-1-Ig (same clone as 68651-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68651-1-Ig (SORL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68651-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 68651-1-Ig (same clone as 68651-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse cerebellum tissue using SORL1 antibody (68651-1-Ig, Clone: 2E7D9 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68651-1-PBS in a different storage buffer formulation.

SORLA Monoclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 68651-1-PBS

Clone No.2E7D9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF-P, Indirect ELISA

Synonyms

SORL1, SORL 1, Low-density lipoprotein receptor relative with 11 ligand-binding repeats, LDLR relative with 11 ligand-binding repeats, C11orf32

---

Product Information

68651-1-PBS targets SORLA in WB, IF-P, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18445

  Product name: Recombinant human SORL1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1865-2214 aa of BC137171

  Sequence: PRNVVYGIFYATSFLDLYRNPKSLTTSLHNKTVIVSKDEQYLFLVRVVVPYQGPSSDYVVVKMIPDSRLPPRHLHVVHTGKTSVVIKWESPYDSPDQDLLYAIAVKDLIRKTDRSYKVKSRNSTVEYTLNKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVLLFWKSLALKEKHFNESRGYEIHMFDSAMNITAYLGNTTDNFFKISNLKMGHNYTFTVQARCLFGNQICGEPAILLYDELGSGADASATQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSFTAFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA

• Full Name: sortilin-related receptor, L(DLR class) A repeats-containing
• Calculated Molecular Weight: 2214 aa, 248 kDa
• Observed Molecular Weight: 300 kDa
• GenBank Accession Number: BC137171
• Gene Symbol: SORLA
• Gene ID (NCBI): 6653
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q92673
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SorLA also known as SorL1 or LR11, is a multiligand receptor belonging to the LDL receptor superfamily. It is also a member of vacuolar protein sorting-10 (Vps10) family and is enriched in the brain. SorLA acts as an sorting receptor for APP and prevents amyloidogenic processing of APP. Downregulation of SorLA has been found in patients with sporadic Alzheimer disease (AD). Currently SorLA has emerged as a potential target for AD therapy. (25404298)