• Featured Product
  • KD/KO Validated

SOX2 Polyclonal antibody

Proteintech has an extensive range of SOX2 antibodies validated forWB, IHC, IF/ICC, IF-P, FC (Intra), CoIP, ELISA and more.
Cat No. 11064-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, zebrafish and More (3)

Applications

WB, IHC, IF-P, IP, CoIP, ELISA

ANOP3, MCOPS 3, MCOPS3, SOX 2, Transcription factor SOX 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells
Positive IHC detected inhuman lung cancer tissue, human cervical squamous cancer tissue, human gliomas tissue, mouse brain tissue, mouse embryo tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman embronic stem cells, mouse embryo tissue, mouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:200
Immunofluorescence (IF)-PIF-P : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11064-1-AP targets SOX2 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.

Tested Reactivity human, mouse, rat, zebrafish
Cited Reactivityhuman, mouse, rat, pig, hamster, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1530

Product name: Recombinant human SOX2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 59-118 aa of BC013923

Sequence: MAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT

Predict reactive species
Full Name SRY (sex determining region Y)-box 2
Calculated Molecular Weight 34 kDa
Observed Molecular Weight 34-40 kDa
GenBank Accession NumberBC013923
Gene Symbol SOX2
Gene ID (NCBI) 6657
RRIDAB_2195801
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP48431
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Background

SRY (sex determining region Y)-box 2 is a transcription factor involved in neural stem cell maintenance and has been used in somatic cell reprogramming.

 What is the molecular weight of Sox2?

34 kDa. Sox2 is an intronless gene encoding xx amino acids including HMG (High-mobility group) box domains that can bind to DNA.

 What is the tissue specificity of Sox2?

In embryonic stem cells, Sox2 is highly expressed and is essential in self-renewal. In the developing embryo, Sox2 is found in the neural tube and then in the developing eye and central nervous system (CNS). This expression is highly conserved across organisms (PMID: 25126380; PMID: 8625802).

In adult tissues Sox2 is expressed in neural progenitor cells, which as multipotent cells can both self-renew and differentiate into neurons, astroglia, and oligodendroglia. It maintains their stem cell phenotype and is a useful marker of early neural stem cells (PMID: 16139372).

 What is the role of Sox2 in pluripotency?

Sox2 acts as part of the LIF (Leukemia inhibitory factor) pathway, activated via JAK-STAT signaling to form complexes with other transcription factors such as Oct4 that bind to DNA and work to control pluripotency. Sox2 was described as one of the four original factors that are key to the reprogramming of somatic cells to induced pluripotent stem cells (iPSCs) (PMID: 16904174).

 What is the role of Sox2 in cancer?

The ability to control pluripotency means dysregulation of Sox2 can lead to uncontrolled proliferation. In many different cancers, Sox2 has been associated with the metastasis and growth of tumors, mostly due to overexpression (PMID: 28388544). The increased levels of Sox2 RNA and protein in tumor tissue highlight it as a potential therapeutic target (PMID: 25114775).


Protocols

Product Specific Protocols
IF protocol for SOX2 antibody 11064-1-APDownload protocol
IHC protocol for SOX2 antibody 11064-1-APDownload protocol
WB protocol for SOX2 antibody 11064-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IF

Cell Stem Cell

The long noncoding RNA lncTCF7 promotes self-renewal of human liver cancer stem cells through activation of Wnt signaling.

Authors - Yanying Wang
mouseIHC

Cell Stem Cell

Injury Induces Endogenous Reprogramming and Dedifferentiation of Neuronal Progenitors to Multipotency.

Authors - Brian Lin
mouseIF

Nat Struct Mol Biol

TDP-43 aggregation induced by oxidative stress causes global mitochondrial imbalance in ALS.

Authors - Xinxin Zuo
humanIF

Neuron

UBQLN2-HSP70 axis reduces poly-Gly-Ala aggregates and alleviates behavioral defects in the C9ORF72 animal model.

Authors - Kejing Zhang
mouseIF

Mol Psychiatry

Pharmacological enhancement of mGlu5 receptors rescues behavioral deficits in SHANK3 knock-out mice.

Authors - C Vicidomini
humanWB,IHC

Nat Commun

TSPAN8 promotes cancer cell stemness via activation of sonic Hedgehog signaling.

Authors - Rongxuan Zhu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Macarena Lucia (Verified Customer) (10-17-2022)

good band

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
FH

Silvia (Verified Customer) (09-30-2021)

It works well for Immunofluorescence on NPC

  • Applications: Immunofluorescence
FH

Ryan (Verified Customer) (02-14-2018)

NaCit antigen retrieval (ph=6)

  • Applications: Immunohistochemistry,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Zebrafish retina 5dpf
SOX2 Antibody Immunohistochemistry, validation (1:100 dilution) in Zebrafish retina 5dpf (Cat no:11064-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...